CAZyme Information: MGYG000000853_01676

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_01676
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1151		128001.85	6.883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 4059; End: 7514 Strand: +

Full Sequence      

MNTSSVMKSRCTKMVLGCIETVCMAVLLFLFHCLPSSAAAAPGGRITMSLSGGGWRLWQD
RGAEWQNDRLWLPDEVTDLRLLPVNPPTDGWQRLDEAGGMAVSVPGTVEEYMTRSERPQP
ADNAGVSWWWRKVCIPAEAAGRRVVIHFESVRMRAEVYLDGRLVAYDVVGESPFCADITD
AVTPGREQTLAVRVTNPGGNFHWQDFEEMHWGKYIIPPGRGFGGIIGRVWIDAVTPVYID
DIYMQNLPQATTVRAVVTVKNTAAKAVRRDVVIGIREKSTGKTVKTHTIKSVLLSPGDNT
VEAELDCSGSGVRLWDLDNPVLYACDVAVKNGRKTEDGNGRTFGFRWFSLEGIGRDAVLR
LNGRRVMLRTAISWGYWPATGLYATPEMAVRQIKTAQSLGMNMLNFHRSIGSPVVLEAAD
SLGLLYYEEPGAFHSAGHDPFVRAIVNIKLQRMVRRDRSHPSLVIYNLINEFGGVRSRDK
ELVAKRMDDMRKAHAIDPSRVMTFTSGWASKENSEEDSKAHMLPYDTVLYRRGWFDNHRA
GGPATWEEGYWRGPNDNFMHTDNRTEVFMRGEEGALSTPPRIAKIAEEMEKTGVTGWDGL
FWKSQMAAFEDYFNKNNLAPYFGTVDSLTRLLGDISLDHQGRRIQGMRMQNTGDVYAVNG
WESMPYDNHSGIVDNYRNVKGNLSTFTYYTQPLYIAVAARTQFVRLPGGKVAADFYIVNE
KDVKGRHRLTVSVIAPDGNEHELTSRMVDIAGGDTFGQLLIENEEIVPAEQPGMHRICAR
LTDDAGRTVAEGHDDVLAVAWQKEQLRGRGAIYGRDADPVAAFYKNATGRELPEYRKDMG
RLDWLVITRSSLDEPQPMPEQPDVDGRPAFSAVYYKDDDMRAEAGTGTDTHIDRTFVGGE
QPHASLAANQSFSIVWKGKIRAPKTGTYLFGVAASDGVRLSVNGGRIVDEWGNNRQTAFS
RPVTLKEGETAEIELQYRQRKPSGNVRLLWSLPGSSTVAPEELLDRVSNDGTSLLVIESA
DSWMDAVARYTGIPYHGYYVVDRNWIGGVHFVKDHPLFRGLPVNCGMGWPYQELVRDGDR
RTGFLLGGGEMVAGSYRSWPFHLGSAVGIVPCGKGRVIYSTLNISSALNKSTGAAEVAKK
LFCNFIEEAAR

Enzyme Prediction     

No EC number prediction in MGYG000000853_01676.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	98	645	1.2e-68	0.5638297872340425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.49e-28	90	473	33	408	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam07691	PA14	2.57e-24	866	1002	1	139	PA14 domain. This domain forms an insert in bacterial beta-glucosidases and is found in other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium prespore-cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal structure of PA shows that this domain (named PA14 after its location in the PA20 pro-peptide) has a beta-barrel structure. The PA14 domain sequence suggests a binding function, rather than a catalytic role. The PA14 domain distribution is compatible with carbohydrate binding.
smart00758	PA14	1.34e-20	872	1002	5	135	domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
PRK10150	PRK10150	2.47e-15	122	506	62	449	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.67e-11	131	494	115	473	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08720.1	0.0	44	1146	25	1127
QMW85532.1	0.0	44	1146	25	1127
AAO78220.1	0.0	44	1146	25	1127
QDO68997.1	0.0	28	1147	6	1126
ALJ60861.1	0.0	27	1151	7	1132

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ED1_A	4.50e-24	125	491	77	447	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
7CWD_A	2.68e-20	123	526	62	451	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	2.39e-19	123	471	68	410	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
6QUB_B	3.31e-19	91	504	36	458	Truncatedbeta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]
6QUB_A	3.41e-19	91	504	59	481	Truncatedbeta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum],6QUC_A Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUC_B Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum],6QUD_A 2-deoxy-galactose reaction intermediate of a Truncated beta-galactosidase III from Bifidobacterium bifidum [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	4.22e-17	68	500	11	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	7.02e-17	144	500	73	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KM09	1.90e-15	123	515	104	465	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KN75	5.47e-15	125	466	87	433	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
Q56307	5.07e-14	120	494	105	465	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.335456	0.646443	0.010336	0.003280	0.001636	0.002843

TMHMM  Annotations     

start	end
21	43