CAZyme Information: MGYG000000853_02268

Basic Information

• Species: Prevotella sp900549175
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900549175
• CAZyme ID: MGYG000000853_02268
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458	MGYG000000853_153|CGC1	51740.56	9.9832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000853	3157276	MAG	China	Asia

• Gene Location: Start: 5499; End: 6875 Strand: -

Full Sequence      

MKLTLRYLLPVLVAVFFSVTVTAQTTKWKEIHKVKKKETIFGIARDNGITVDELVKANPE
MASPDYKLKKGSTIFIPYPSAASAKPAGGSAGASQAGAAKNGVDMRNREIRVGVMLPLHD
VNGDGKRMVEYYRGVLMACDSLKQNGISVDIRAWNVPEEADITKTLKDKNAARCDLIVGP
LYSKQVKTLSDFAREHDIKLLIPFSINAPELQTNKNIFQVYQNQAEYNEAVIGRFLEKFA
GYHTVFIDCNDTTSKKGVFTFGLRRRMEAMGRSHSITNLKSQEAQFAKAFSTTMPNVVVL
NTGRSPELNVAFAKLNNLTMNSPKLEVSMFGYTEWMMYTKYNLDNYYKFNTYIPAVFYMN
PLSAKTARMEQKFRWNFHADMQQALPRFAITGFDHAYYFIKGLHMYGRNFTGARGLVGYT
PIQTPLHFERVAEAGGYRNGSILFVHYTTGHRIETINF

Enzyme Prediction     

No EC number prediction in MGYG000000853_02268.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	2.52e-08	31	76	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.77e-07	31	76	1	44	Lysin motif.
pfam01476	LysM	5.05e-07	32	77	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
cd06339	PBP1_YraM_LppC_lipoprotein-like	7.09e-05	111	219	1	103	periplasmic binding component of lipoprotein LppC, an immunodominant antigen. This subgroup includes periplasmic binding component of lipoprotein LppC, an immunodominant antigen, whose molecular function is not characterized. Members of this subgroup are predicted to be involved in transport of lipid compounds, and they are sequence similar to the family of ABC-type hydrophobic amino acid transporters (HAAT).
COG1388	LysM	6.83e-04	17	77	54	111	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ80666.1	1.98e-181	31	458	32	450
QUB46898.1	9.70e-175	6	458	7	451
ALO48876.1	4.13e-163	1	458	1	448
EFC70285.1	1.77e-153	1	458	1	454
QYR10688.1	4.02e-146	6	458	3	450

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000276	0.999105	0.000165	0.000150	0.000141	0.000134

TMHMM  Annotations     

start	end
7	26