CAZyme Information: MGYG000000854_00007

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00007
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1053	MGYG000000854_1|CGC1	117269.68	5.9899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 9788; End: 12949 Strand: +

Full Sequence      

MKRLLILMAGILCLTGVATAQQRRPIDSQHPLWMIHIDVWNAADPQKIIDLVPEDIRPYV
CMNLSLSCQYDKERNVYKMPRSAVRTYKSWATICQQNGLWFTCQPASGGRTHLQTDDLET
FEYFFKRYPNFLGWNFAEQFWGFDEDDKGSATQVGQIALFANLVKMSHEYGGFLTISFCG
NIWSHGLSPVGMIKRNKNLLQACRDYPDAILWLYKYTMSGCFYNAESCTLSPFISGLAKN
YGVRYDRCGWCSAMDIAVGQNMAKYPIAAGIGTVMEQCGVNGGAVWDGPETIPDECFKEA
GRTTVNGYTIRNWESYDGFKGAWIDMFRKVIDGTLYIPTRKEVVDSTRIVILANTTSGSD
EDKYATWGSLYDGLYKQDDPTNREGGQFMRNNCYFKSTGRYRAIPLAVELADPLAQSIPL
QLNRATAKSRWSTEAKKVAEYNSYYPELSEGDLFVSRVQNQLVTYMPYTYLNNKKTATGR
VPLLYNTCDSLTLTLGTLGSGIVREYNDHIDFYLNNYRTDTTTLVNETIVIKGATTEPSY
TMKTGLLAKGNVTAEWNAETGTYTLSVKHRGGIDVTVNCSGNAIGRKTDAPVLSALPIPK
QPDEYHGEIIIEAENMDYKNVKDIMLVNPYGNYFPEIVEFAGNGFVDMGTNTSGTLRHYL
NIKEAGDYTITVRYISAAKAGKMRATVNGKSTMLNIEKTGASEWRKVTFNATLKAGKNTL
LLTNPGALSMYIDQVVYTPADMEAERFLITVRDADHGTVTSDIDEATEGETVTLSITPDE
GYILTALRMVNGVHFTLGTTFSLASYDVENSTLTFVMPDDQVTLQPVFKKANEVNAIYRL
DFSNTYAGALPPGWRCVQANEEVHEYPQTYNLGTRTLSGFTGYQGKALYWRDNCAEYGRQ
DAFPLKLSAGNYSLSFATAAWKGAPQYKVKIMDTDNTVMAETDAYTATPNASGNTSAILS
STRTIELPFTIAQDGNYVIRFEDVSADGGFHEFLLLDCVVSPVSKPDCINIVSADGSRTY
TIYGIGGERRSTMRRGLNIIRTADGKAKKVFVK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	20	335	7.9e-81	0.9908256880733946

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	2.73e-86	19	335	4	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
pfam08307	Glyco_hydro_98C	8.39e-15	340	578	1	268	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd04083	CBM35_Lmo2446-like	5.60e-10	640	737	23	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04082	CBM35_pectate_lyase-like	3.44e-07	640	723	22	109	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04080	CBM6_cellulase-like	2.93e-06	609	720	3	127	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB29515.1	0.0	4	1052	9	1034
QUT78600.1	3.19e-162	19	736	224	935
QUT26887.1	3.19e-162	19	736	224	935
QNL40606.1	5.48e-162	23	736	226	930
QRQ55178.1	2.44e-161	19	736	224	935

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMH_A	4.96e-12	194	577	202	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMG_A	8.62e-12	194	577	202	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMF_A	1.97e-11	194	524	202	491	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000453	0.998751	0.000221	0.000206	0.000173	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00007.