CAZyme Information: MGYG000000854_00009

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00009
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830	MGYG000000854_1|CGC1	94584.54	7.993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 15493; End: 17985 Strand: +

Full Sequence      

MKKLIATICAIFVCFSAQSQNFCIAEKGRTAPIVVDDKDWTGVIRAARDLGDDVRKVCGM
ASEVTATSKFLQKREGSIIVGTIGKSKPIDQLIKQRKLDAGKVRGQWESFVIDVVDGNLV
VAGSDKRGTIYGIYEISRRIGVSPWYWWADVPVQHQDDIYWNDGRFVQPSPKVKYRGIFI
NDEWPSFGEWSTAHFGGVNSQMYAHMFELLLRLKANYLWPAMWSSRFNEDDPLIPKVADE
YGIVMGTSHHEPMMRAHKEYTCRKDSVGPWDYSINKQRLDKFFLEGMQRNKDYDNLVTIG
MRGDGDVAMGKGDDEENMKTLHEVINGQRQIIKKVYGREDGVPQLWAIFTEVQRYYDAGF
TVPDDVTLLLCDNNWGYIRRIGRDFEQKRKGGLGLYYHIDMNGGPWNDRWVNTTTIPKLR
EQLNLAYQTGIDRIWIVNVGDLKPKEVPIDFIMHYAWNPDAVKAGEEQAWLEQFTGSVFG
KENAKEAAYLIARYSKYNLWRKAEVQVPGIFNSKEMAYTDSLWLSLSARAEALRTKIPAD
AQDAYYQLVYYPVIASAGVALLYNASTRNNKPLVQQLMARDRQLSDYYHQINGSKWNKMM
QDRHIGYTRWSMPNKNTAPTTQGFDVGHTTDNQPATKEYTIAAHKYTRKTDGKNASWMFL
PDLGRGEGCMGSSNVQSQNCGATLEYEITLTDEGKVAIGILPTQDICPPRGLRIGIQIDD
RPMQTIDARRGLVDTFAEYNPKNLTRSKVLQPLPPHSRLALSGFWKGKQLPRRNEVFDNL
RWLDATFTDCAAGRHTLKIIMIDPEIVVEQIVVNPDDNHYSYFGAGYAIP

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	20	811	1.8e-232	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	170	505	2	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.57e-24	642	824	13	169	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	1.18e-05	64	135	50	119	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ50360.1	2.57e-317	31	825	28	963
EEC55419.1	6.02e-317	31	825	53	988
QUT25621.1	1.26e-313	12	824	34	1003
QRQ59056.1	1.35e-313	12	824	5	974
ALJ47135.1	3.14e-313	12	824	30	999

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	2.11e-177	24	631	16	641	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	9.29e-162	12	822	34	843	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	3.46e-161	20	814	15	820	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.59e-158	20	814	14	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
6NPS_A	3.54e-125	19	611	8	646	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000516	0.997292	0.001546	0.000213	0.000210	0.000214

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00009.