CAZyme Information: MGYG000000854_00034

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00034
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785		90352.18	7.3353

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 56196; End: 58553 Strand: -

Full Sequence      

MKVDIIVPIYNAFDDVRVCIESVIQHTDLSNHRLLLINDRSTDSRILPFLKQAIEDNKSL
NIVLKENIENLGFVGTVNVGMGASENDVVLLNSDTKVTARWLEKIQKCAYSKNGVATVTP
LSNNATLASVPDFLIENEIPADTALDEYADIIEDCSMRLYPEIPTANGFCMYIKREAINI
VGAFDEKNFGMGYGEENDFCYRCLQIGYRHLLCDDTFIYHKGSQSFKEERKLLAQKHLSI
LKTMYPDHFLNTDLFQQKNPIFPIQANVRYGYGVYKKKNILVLIHVFQDPPIGSVGGASM
HVYDLVKNLLHLYNFHVLYYSEANSAYFVTSYFDDATVTNYLGACPKYTSPNLYNDTFKE
YLLRSMDLLGIDLIHVHHLLDLYLDVFPVAQSKGIPVVFSIHDYYTLCPSINLMDIDKRP
CNFYETRDCKRCATGRWGCKGDFMMLWQKECHSCLETAKKIIAPSEAAKDIFQSFYKDLD
VDVIEHGYRPGEVIRINRQESSKTFNIAFIGGISEIKGLSYLRGLKEKVRGTNIVIHLFG
MTRDSMVNVSSKNFVYHGQYVREELLKRLRESDVKLICLFSICAETFSYTLSESLLAGIP
VITLDIGAIAERVRKIDAGWVMPYDCSMDDIYRTIERIKTDSMEYISKVENITRYLKHAK
STEDMAHEYSVIYDGLIRQYPVNKNYSDNVSEKRLFYQNLKSPLLINENNIFSIQTEFLR
LKNLIIKGDAPLSVAIAEVKKFRSLAKGSHLRNKIVYKLIWYRFVYKYVMCATIGFWENM
KRFFR

Enzyme Prediction     

No EC number prediction in MGYG000000854_00034.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	2.22e-35	279	673	1	355	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
COG1216	GT2	2.42e-27	1	228	3	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd03801	GT4_PimA-like	1.07e-25	279	641	1	333	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.49e-23	284	679	3	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04186	GT_2_like_c	2.77e-18	5	222	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT32101.1	4.09e-286	1	765	1	767
CBK67716.1	2.59e-285	2	765	15	780
QGT72879.1	4.04e-278	1	763	1	762
QNL40326.1	5.73e-278	1	763	1	762
AIQ20837.1	4.21e-151	4	711	8	714

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00034.