CAZyme Information: MGYG000000854_00210

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00210
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878		100569.72	5.997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 77908; End: 80544 Strand: +

Full Sequence      

MIKGARILVFIISLFISLSNHAGNDSFPVRFECEDGAFPLVVSGKAVPIITDCIDDKGIL
RAAGDLQADIEKVTGIRPVLVRETEDAVEAVIIGTVGKSKIIDRLVREGRLRKPDLQGKW
ESFVTATLDAPVKGIDRAVVIAGSDKRGTIYGMYELSQKIGVSPWYWWADVAVPRHEEIY
ISRHYYASGEPKVKYRGIFLNDEFPCMTAWAREKFGGMNSKMYAHLFELLLRLRANTLWP
AMWGSFKEYKPLVPVLREEDGRWAGNCFNEDDPENPRLADEYGIVMGTSHHEPMQRSQQE
WIRHKQEYGNAEWNWKTNKEALYRFFTEGIEHTKSYESLVTIGMRGDEDREMADAGSEEA
NFRILEDIIKEQRRIIAKATGRPAEKTPQVWTLYKEVQEYYEKGLKVPDDVIIMLCDDDW
GHVRTLPSPEGKRHKGGYGMYYHVNYYGAPRAGKWLTMSGIAEMWEQMSLAYEYGVDRLW
MLNVGDLKPNEFVTDFFLRMAWEPERFHAGNLKEYAEEFCRRQFGDAIAGEAAALLMAYG
RYASRVVAEHMDEQTYNLETGEFKAVRDELMALEARALRLFVSLPASAVDSYRQLLLYPI
QGMANLYDMYYSLAMNRRLYDLQLPEANEWADRVEACFMRDSLLCAEYNHVMSGGKWNHM
ADQVHIGYTSWHAPRENIRPRTMRMVLPEKTDSLKDGFAFQGRNGVVVMEAEHCFSFRQA
SSDTRWTVVPWLGRSRSGVTVMPRTEKVAGSELTYRMRMDASVDSITVHLVFATLMPFVA
GGHYVSVAWDGKSAGEIGINQELVWENKYTQMYPAAAARVIEKTVTLPCQPTADGWHELI
YRPLSPGIVLEKVIVDYGGYETTRLFMPESRYERVLHN

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	36	853	4.2e-254	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	189	550	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	2.14e-27	704	869	6	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.001	62	156	36	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APS38643.1	0.0	34	874	41	851
ALJ48335.1	5.62e-309	5	877	4	844
EDO10801.1	6.25e-309	5	877	7	847
QRQ55179.1	6.25e-309	5	877	7	847
SCV07743.1	6.25e-309	5	877	7	847

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	4.02e-285	29	874	35	853	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	9.92e-264	22	875	1	839	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.49e-261	32	875	10	838	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	1.07e-178	35	680	11	629	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	7.80e-128	58	688	31	660	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000246	0.999124	0.000180	0.000149	0.000144	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00210.