CAZyme Information: MGYG000000854_00216

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00216
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852		98543.92	6.8772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 91006; End: 93564 Strand: -

Full Sequence      

MKKDFFRIALLCIVTAIPSCLSAAERFVAFRPENGCTLLQTQENTLHIFINEQEFQGIKT
ATNNLVRDISSVTGKQPETVGRLTPNTRLVVGSIEKSDIIKRLIKEKKLNGKELQGKREK
YIITTVNDNDNTYTVIAGSDKRGAIYGIYELAEQMGVSPWYWWADVPVEKHKELYILPGT
YTDGEPAVRYRGIFINDEWPAFGGWAKEKFGGINSKMYVHMYELILRLKGNFLWPAMWAS
AFYEDDPESSRLADEMGIIIGTSHHEPMARNHQEYARRRKEIGPWNYDTNKDGLNRFFRK
GIERIKGTEDIVTIGMRGDGDEPMGKDANLQLLERIVADQRKIIRDVTGKKPEKTPQVWA
LYKEVQEYYEKGMRVPDDVILLLCDDNWGNVRLLPDLQEEKHKGGYGMYYHVDYVGGPRN
TKWINVSQIQRIWEQMQLTYSYGVDQLWILNVGDLKPMEFPIDFFLRMAWNPGRFNAGNL
MEYTEAFCRQQFGEREAKEAARILNLQGKYVHRRTAELLWHNTYSLHTGEWERVLGDYKR
LESDALNQYQLLDEKYRDTYQELILFPVQAMANLYDMYYAYAMNSRLAAENHPEANDWAD
RAYRLYLRDSLLCDHYNKHIAGGKWNHMMDEIHIGYTSWNGPKKRYFPAPQRVNADSVNA
ARKQNGNPDKGYVFTSASPKGIIAMEAEHYWKATDGTKTQWTVIPDFGKTLSGLALMPYT
EPTDQGEVTYKFQSSKDGEVMIHLYLAPTFPFNDNKGQRIEVRTDEGKPQILNINSKKEE
YQWQANRINIGTVKMPLKHKDDGMHTLTLSPLDPGVVIERIVITRIADGKEVKADYNYLG
EPESPYHIENLK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	39	821	4.1e-268	0.9913916786226685

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	184	518	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	6.19e-39	681	843	7	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	9.37e-11	56	151	31	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58215.1	0.0	7	823	9	837
QUT90767.1	0.0	11	823	15	837
EDO10801.1	0.0	1	846	1	842
QRQ55179.1	0.0	1	846	1	842
SCV07743.1	0.0	1	846	1	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	1.00e-314	23	844	30	851	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	2.04e-290	37	823	18	819	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	2.58e-288	37	823	17	818	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.10e-184	27	845	5	934	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	4.60e-138	38	846	11	965	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000851	0.541530	0.456967	0.000252	0.000189	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00216.