CAZyme Information: MGYG000000854_00719

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00719
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		47504.45	8.1269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 87897; End: 89147 Strand: +

Full Sequence      

MTRKFLRKGTAFACVLFLFAACHETEEKRISPLGIEDGETTETAYDLDKIQETGELIAVT
LSGPDTYYEYRGKGFGLQYELAERFAVYIGTRLRMETAKDTAELFRRLKNGEADLIALEI
PHRDTLDDDIQYSGSWSDVCDTSTHTQKQWMVRKNSPDLAEALRHWYSPELRKTLLTAEQ
ERYKTDRSIRRKMRAPIQNRAKGIISAYDNHFIRHSQAMGWDWRLMAAQCYQESGFDPQA
VSWAGARGLMQIMPETAAHLGLSANHINSPEHNIAAAAQYLRELNRTFSDVSGRMDRINF
VLAAYNGGAGHVRDAMALARKHGKNPHKWEEVSYYILQLSQPKFYNDPDVNFGYLRGQET
YDYVKSINERWQYYRGAVPGAGGGSIPSPSKKNLRNGYKSKVLSAEELERKSQLEQ

Enzyme Prediction     

No EC number prediction in MGYG000000854_00719.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	216	370	9.2e-29	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	5.19e-76	212	375	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	2.23e-62	1	367	1	443	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	1.03e-53	46	367	15	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	4.05e-26	212	327	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	4.01e-25	224	317	2	90	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15587.1	9.46e-119	15	384	41	404
QUB48180.1	7.44e-116	15	395	12	389
AGB28026.1	1.08e-112	12	399	33	410
ALO48082.1	3.58e-108	14	399	7	388
QNT65891.1	6.15e-108	8	398	4	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OYV_A	2.56e-30	47	374	11	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OZ9_A	6.05e-30	47	374	4	418	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OWD_A	6.61e-30	47	374	11	425	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA2_D	9.66e-30	47	374	45	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	3.34e-29	47	374	45	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0A9W6	2.23e-30	47	372	37	452	Membrane-bound lytic murein transglycosylase F 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=mltF1 PE=3 SV=1
A8ZWR8	3.32e-29	49	367	36	441	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A4WDC7	3.33e-29	50	369	39	446	Membrane-bound lytic murein transglycosylase F OS=Enterobacter sp. (strain 638) OX=399742 GN=mltF PE=3 SV=1
Q9KTN5	3.69e-29	41	372	29	459	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltF PE=3 SV=1
A5F353	3.69e-29	41	372	29	459	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000042	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00719.