CAZyme Information: MGYG000000854_00940

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00940
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
755		83762.42	5.8965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 44097; End: 46364 Strand: +

Full Sequence      

MKKKLLLVVGLMATMCASAQDALRYKDASLPVAERVEDLMRRMTLHEKCLQLQNNSTSDI
NAIEGMYGNESPGSVHEMSKSAAEAALLFDKMQRYLLSQTRWGIPALTSVEGIEGVLQNG
CTIFPQAIAQAATFNPDLVEQMAGAIAREARVIGVRQVLCPVLDMARELRWGRVEETYGE
DPFLIGEMGTRYVRGAQAEGVGAMPKHFVAHGTPSGGLNCAHVSGGERELRNLYAYPFAK
VFRDADPVAVMSCYSAYDGVPMAHSAYYMTDFLRGELGFKGFVYSDWGSVDRLRIFHFAT
ESSAYAAKKALEAGIDMDVWDNAYQTLEEQVRKGVVDEFYIDRACRRVLTAKFRLGLFDD
PYGDPSKVDKVVRCKEHVALAKKMADESIVLLENKNDILPLDMNRYKNIAVLGPNSNYGV
VGDYGWVGRDHHECVTLYDGVKAALGKQATVTQADGCDWWSQNGDGIAEAVRLTEQSDLA
IVAVGTRSWWLGRDAKGNRATSGEGFDLSSLELPGRQLDLLKAVKATGKPVIVVLITGKP
LVMTWAKENADAVLVQFYGGEQQGNAMADVLLGKVNPSGRLNVSFPRSTGNTPCFYNYYP
TDRENVYDKGGTYEEPSLHYIFERPYAIWNFGYGLSYTDFEYSDLQLNDTVFAADGVLKA
RVTVKNTGKRDGKEVVQLYVRDKISSVSQPIQALKAFKKVEVKAGKQVTVDLEMPIDELA
FYNEYMKRVVEPGEFEIQVGRSSDRILFNRTIVVK

Enzyme Prediction     

No EC number prediction in MGYG000000854_00940.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	98	319	3.7e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.33e-170	3	746	2	757	beta-glucosidase BglX.
COG1472	BglX	9.36e-88	43	426	1	371	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	3.66e-81	16	740	32	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.45e-68	389	637	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.44e-67	92	351	54	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61926.1	0.0	1	755	1	753
ALK83130.1	0.0	3	754	5	756
ABR38447.1	0.0	25	755	30	757
QQY38586.1	0.0	25	755	30	757
QEM11461.1	0.0	19	755	25	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	6.29e-171	24	755	6	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	4.97e-170	24	755	6	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.79e-129	12	754	23	785	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	3.05e-117	36	743	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.66e-116	36	743	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	3.58e-137	101	743	62	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	4.53e-120	25	743	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	5.67e-115	36	746	38	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	4.31e-114	36	746	38	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
A7LXU3	2.49e-87	103	753	123	775	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000897	0.699594	0.298683	0.000293	0.000261	0.000240

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00940.