CAZyme Information: MGYG000000854_00963

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_00963
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1227		134198.49	5.0432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 68; End: 3751 Strand: +

Full Sequence      

MMIRKQLQAIVATLAVGCCLQPLQAKMPAGTETVRSGMKQQVWVAPDGNDLSAGTAESPF
ATLQAALSHVRALRQSADAGKLGEVHIVLKGGTYRLNSTLTLTPDDSGTPTSPTIIEAAE
GQTVVLSGGAVVSGWQDTGIVDGLPAVAQGNVWKAAIPVVNGSAVSFRQMWAGTNKMRRA
STFDDQSLPRLISVDKTKGELTVPRIEQTFRNPGQVEMTIIQDWVTNVMRVKSIMSVGER
SVLKFQEPESAIEFKRPWPILRADEASHSNHMFYLSNAIELLNRPQEWYSDEAAGELYYW
PRSGEEKQTFEAVVPVLETLVDIAGTDERKVQHIAFRGITFAHSSWLRPSVSGHVPLQAG
QWLHDAYTDPSSPAGNVAWVGRPKAAVSVTDACSVSFEGCHFRQTASTGLDFVSGTKRMT
VRGCTFSDIGGSAILAGYFGDKDFEAHQAYHPVDLSVVCDTIVIDNNYIAHVATEDWGCL
GVCIGFAANVSISHNEIFDTPYSAISMGWGWTKDTSCMHDNHITGNYIHSFSNQMRDGGA
IYTLSSQPRLSVERNRIEDVGDPKFNPLMWDMRHAQFDIYLDEGSDYFTVKDNWCERGEV
NKNKNGGHNTWGTNNSSVSATVKDAAGLEPSYWHLRQSVPVSDMAPVDSIGDDNSGKDRV
EYIAPGEGFKLGNAMAVDLNGDNRLDIVYAGGESHQVQQGGVRINMGNYSFAATQGLRRV
YMSNFAAGDLNGDGHIDLLQAGWDFWDSYNALWMNDGTGRLTEQRLVSAKNTSPACGIAD
VNNDGLSDFFFVGNKTDNSFYLQRQDRTFAPAVAKLKLPGGFSDPSMVYADFNNDRSVDI
CLLSNKTGGVYTRMFFNDGKGNFTERNVGLSERGTRGGMAYADVNGDGYLDLVVGGYYYG
EQWNSTAADGGKVVTLYLNNGDGTFAKHQEFSEYLFDNVTQPVRFCDWDNDGYADLIVTG
WNMSQGNVSRTDIYLNDGQGNFTLLPDTRLPGVSESSVELADFGNSGRSDILISGNCNGH
YQGMPGDRRIAVLCRNRTANTNTAPTAPVNLKTEVSTDGTVHLSWDAGADNETPTPSLSY
NYYLRNLSTGLYMTFPNADIATGQRRVSQMGNAWLNHGWTLNNLPPGNYAWSVQTIDASY
TGSPFAVEQQFTISESTAIREHAASTDSIRISVVSDGLQIETGEAQAINVFMPDGRKYLT
CRLQPGINRVSLPRGLYIVHNTKVIIR

Enzyme Prediction     

No EC number prediction in MGYG000000854_00963.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	41	597	5.9e-179	0.9924098671726755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13517	VCBS	9.56e-10	883	958	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
pfam13229	Beta_helix	1.47e-08	412	593	4	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13517	VCBS	2.32e-08	831	894	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
pfam13517	VCBS	8.22e-08	947	1013	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
pfam13517	VCBS	2.11e-06	729	791	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHJ06747.1	2.37e-165	42	637	24	622
SDT16678.1	4.72e-164	42	648	26	640
AWW31202.1	5.74e-164	38	636	23	626
QJD97296.1	5.77e-163	41	635	24	625
BAV05177.1	2.45e-161	42	635	26	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	3.61e-151	41	637	26	624	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000786	0.593186	0.404852	0.000502	0.000390	0.000266

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_00963.