CAZyme Information: MGYG000000854_01154

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_01154
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1426		162505.56	6.761

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 17939; End: 22219 Strand: -

Full Sequence      

MSALAVTLTVTANAGNVLSVIRKTDNGIVMGRDGELLKVEFVNPAVVRVQYVPEGQLTDN
GTIVCLPRETRKTAGFKCRESKDKTMMKSGLLTVEIDHKTGAICYKAADGRLLLKENGDN
PRQMERIAIEKTVYDDSKSKVEKTANGDLMVSEVASRKQVGSAWKARQQFQWQQGEALYG
LGSHQEDYMNLRGTMQYLYQHNLKATIPVLMSTNGYGLLFDAGSTMVFRDDAEGSYMQMD
AVNEIDYYFMYGPEMDDVVAQYRSLTGKVGMMPRYLFGYVQSKERYPDQHTIDSVVTRFR
NERIPLDVIVQDWNYWQPKWWGHKKFRADAYPDPKGMIDGVHGKNVRFMLSLWPTANGNE
GQEMGAKGYVLGRGIYDAYNPDSRKMYWDEYVNKNLFSYGVDAWWCDGSEPIDGDWNAKA
NDIAYNPKARYELNTRELHALLGIMRSNTFSLNHSRGVYENQRLTTNDKRVVNLTRSTYA
GQQRYSTIVWNGDTKATWQDFAQQIPSGLNYMITGSPYWTIDAGAFFVKSGNSWFWKGDF
QKGTMDMGFREFYVRNLQFCQWLPMMRSHGTDCAREPWQFGKPGEMFYDAILEQINLRYR
LLPYNYSVAASMMLDDRTMTRPLVFDFREDANVYDIKDQLLFGPAFMACPVTRPMYYEAE
SKELSGISKSRRVYLPKGTEWTDFYTGKRYEGGSLITAAAPIDRIPVFVRAGSIVPMGPL
QQYSSEKPDAPWEIRIYPGADGEFTVYEDEGDNYNYEQGKYSTYTLRWNDRSRRLTISER
KGSFSGMTKSRRFHIVIVGEGRGTGVDITTDADATVEYDGTPQSISLTTAFPVKQGKAVA
FGNADVRLTDSWVKQREDLDIAFLKSLDPDRLLHNFRTNAGLASDAQPLEGWESPKVGLR
GHFVGHYLSAVAAIVEKYDEPQLKKNLQYLTDELQTCQNTFGNGYLSAFPEKDFDTLETR
FGGVWAPYYTYHKLMQGLLDVYTRTHNKKAYDMVKGMADYACNRMSKLDAATIGKMMATT
KANPQNEMGAMNEVLYKLYRLTSDPKHLALAKMFDPDWFAGPLAESKDILSGLHSNTHIV
LVNGFALRYGVTGEEQYRDAALNFWNMLTQSHSYANGSSSGPRPNATTRTAMSAEHWGFP
CHLCNTLSGEIAESCVSHNTQKLNSYLFSWTADPKYADAYMNLFYNAVLPVQSNRSGSFV
YHLPLGSPRTKKYLKDNDFFCCSGSSAEAFAQLNNGIYYHDDSTLWVNMYIPSVVEWKEK
KVSFRQDGNFPKNPEVSFEVSAGRKSEFAVKLFVPAWAHDVEVYVNDVRQDVALSPSSYC
TLKRTWRNGDKIRLRFSYEFHVKPMPDNENMFAIFYGPMMLAFENCPELLLERDVADVLR
NIEMTDEEEMTFRLKNGGNSYNLRPLFDIDRQTYGVYFMVGANSCK

Enzyme Prediction     

No EC number prediction in MGYG000000854_01154.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	845	1362	1.3e-170	0.9980119284294234
GH31	247	715	3.6e-121	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.02e-139	845	1362	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
pfam01055	Glyco_hydro_31	2.06e-136	248	715	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06591	GH31_xylosidase_XylS	4.55e-132	267	598	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	1.04e-130	42	802	58	758	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
COG3533	COG3533	1.83e-81	846	1375	12	514	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT73061.1	1.91e-301	26	827	21	823
QNL40586.1	5.25e-301	10	820	21	835
QDM12716.1	1.21e-299	26	827	21	823
QUT78610.1	7.92e-299	26	827	45	847
BCA51630.1	2.45e-298	26	820	18	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JOU_A	3.11e-136	36	827	48	955	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
7KMP_A	5.86e-129	4	825	44	975	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	1.33e-109	245	825	403	984	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6YQH_AAA	1.20e-64	841	1362	28	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
6JR6_A	6.97e-62	149	781	129	759	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXT0	1.66e-135	36	827	47	954	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q9P999	8.31e-132	37	820	8	722	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A2QTU5	1.28e-54	161	708	150	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
Q9F234	1.07e-53	33	761	43	721	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q01336	4.54e-53	161	577	130	527	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_01154.