CAZyme Information: MGYG000000854_01155

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_01155
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		62469.88	7.7486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 22240; End: 23868 Strand: -

Full Sequence      

MCFMKRNVVTTAMLVAFMTAAWAQDYRVPVTDEKEKMAEGQYQPQWESLEKHKTPEWFRD
AKFGIWAHWGPQCVEGTGDWMARSMYMEGSYPYKYHVEHYGHPSEFGFKDILPLFKAEKW
DPDKLVERYKRLGAQYFFVLGNHHDNFDLWDSKYQKWNSVNIGPKRDILDGWAKAAKKHG
LPLGISFHADHAWLWYEPAQRYDLNGPKAGVYYDGNLTKEDGKGKWWEGYDPQELYAQKH
PMSQKSWDNGRVHAQWAWENGACPPSKEYVTNFYDRTLDAINRYNPDLIYFDVTVVPFYK
ISDCGLKIASHFYNKNPRAVMFGKILDDNQRKALTWDVERGAPNEIIDEAWQTCNCIGGW
HYDTSLYERNGYKSADKVIKQLVDIVSKNGNLLLSIPLRADGTYDEKEAAILDGIEAWMT
VNKESIIGTRPWVKFGEGPVAEKDIKINAQGFNEGMYNNLDSRDIRFNQTAKHLYVTPLG
WPEDGKVVVKSLCKGNPHFKKGITSVELLGYGKVKARQTAEGLEVQLPKPTNAIAPVLKI
RK

Enzyme Prediction     

No EC number prediction in MGYG000000854_01155.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	25	428	2.1e-100	0.9682080924855492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	8.46e-118	36	492	1	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	5.51e-104	38	424	2	333	Alpha-L-fucosidase.
COG3669	AfuC	1.39e-92	68	542	1	426	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam16757	Fucosidase_C	1.57e-07	467	540	13	89	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.
pfam17170	DUF5128	0.010	273	393	51	172	6-bladed beta-propeller. This family is a 6-bladed beta-propeller structure of unknown function. There is a highly conserved FDxxG motif which might be important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49772.1	0.0	21	542	17	538
QUT44310.1	0.0	4	542	24	561
ADE82672.1	0.0	13	542	1	529
QUT88746.1	2.28e-299	23	542	19	546
ALJ60261.1	1.87e-298	23	542	19	546

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LJJ_A	2.50e-78	50	541	52	509	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	1.34e-77	50	541	52	509	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
4NI3_A	4.29e-62	38	540	3	489	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
1ODU_A	7.24e-48	42	539	8	445	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]
1HL8_A	7.24e-48	42	539	8	445	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9BTY2	4.09e-31	42	531	34	449	Plasma alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA2 PE=1 SV=2
P48300	7.38e-31	42	537	37	453	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1
Q5RFI5	1.00e-30	42	531	32	447	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
P17164	2.43e-30	37	537	28	450	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
P10901	5.12e-29	41	528	20	428	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000420	0.998780	0.000195	0.000217	0.000190	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_01155.