CAZyme Information: MGYG000000854_02117

Basic Information

• Species: Paraprevotella sp900548345
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella sp900548345
• CAZyme ID: MGYG000000854_02117
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		53650.08	6.5009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000854	2733305	MAG	China	Asia

• Gene Location: Start: 7217; End: 8608 Strand: +

Full Sequence      

MSLKLRSVLVALACMMFFPSYGNDRLKEMQQKFVNDKFGMFIHFNMPTFVDEDWPAPETP
AETFYPKKLNCNQWADAAISAGMRFGCLTTKHHSGFCIWDTKTTDYNVMNSPLKRDVVRE
YTDAFRKKGLGVMLYYSILDTHHRLRPGFITRSHVDLIKGQLKELLTNYGEISAIIIDGW
DAPWSRISYEEIPFDDIYHFIKQLQPNCLVMDLNSAKYPQDALFYTDIKSFEQNAGQHIS
KDTNRMPALSCLPLNSSWFWKTDFPVTDVKSPEWIVNENLIPFNKAYCTFILNVSPNTDG
LVDDNACKALKEIGRLWKGKEGGEMVLGDYERPITAENIAKHRPAKSSWSDDSFIMDFGN
DDNFSSAWHTNKRIEEPWYEVDLDRTRPFNMISLADNNESFSSYCVYYEKDGVWHEIPLQ
VKPGKVKVHRFGTVWGDKVKVVFKKNGEKMYLSELGVYNERRD

Enzyme Prediction     

No EC number prediction in MGYG000000854_02117.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	26	318	3e-71	0.8670520231213873

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	5.96e-47	27	317	16	327	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	1.10e-45	29	315	19	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	3.38e-27	28	324	13	318	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam00754	F5_F8_type_C	7.36e-05	361	417	19	80	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	0.002	359	417	31	92	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS60268.1	4.18e-215	26	462	32	467
ACU63878.1	5.61e-213	25	462	31	467
ASZ14127.1	1.51e-210	26	462	32	467
BAU53564.1	2.43e-207	22	462	29	468
SDT40017.1	1.72e-206	8	462	9	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GN6_A	2.79e-44	31	328	32	353	Alpha-L-fucosidaseisoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_B Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_C Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_D Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_E Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus],6GN6_F Alpha-L-fucosidase isoenzyme 1 from Paenibacillus thiaminolyticus [Paenibacillus thiaminolyticus]
5K9H_A	2.58e-34	28	210	41	233	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6ORG_A	5.70e-27	28	458	13	448	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
3UES_A	7.29e-27	41	315	34	345	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
6OR4_A	2.61e-26	28	458	13	448	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.95e-32	40	461	52	480	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	2.69e-29	19	460	40	478	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q99LJ1	2.87e-14	10	315	16	346	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
P04066	5.36e-14	17	372	37	391	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
Q60HF8	9.56e-14	17	372	39	393	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000264	0.999125	0.000167	0.000157	0.000139	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000854_02117.