CAZyme Information: MGYG000000857_00997

Basic Information

• Species: CAG-269 sp900552555
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp900552555
• CAZyme ID: MGYG000000857_00997
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515		58283.26	4.3164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000857	1764654	MAG	China	Asia

• Gene Location: Start: 36425; End: 37972 Strand: -

Full Sequence      

MIEAQRENLNINKLIAERKEIILAEGDMIVPDSKPDILNTIGTSGIASIYKKEVQSEKVR
LDGTVNTYIMYMPDGADDTVRGLNTSVDFSESLNVPNCQEGMNAISDVKIKSIEAKVING
RKIGIKATLEVNLKIYSNDNVEIINEVQNEDDVQILKEDLKLNSLVGTGSTKIYAKDNIQ
IDNMDNLAEILQAQVCLVDKDIKISYNKVLTKAEAEIKIMYLTEDNRINVVTYKIPVVGF
IDIPDVSEENICDVNYEIKNIIIKPNSQDEHSIYVEIEIEVTCCAYEEKQINLIQDMYSP
TQNLNFEKKQITTMTSKQNISGVKQIREKINMSDIDGLNLLDVETTPVILNENKINTKIM
YEAELNMKFIFENSRKQINVKDAKIPFEYTIENLQNGESLNTNCDMGIKSQDFIIQDGGN
ISCNVDVQADTSMYRTANLNMIDSIVEDGEREEQDYSLVIYVVKKGDTLWDIAKEFGSTV
DGIARTNGIEDKNKIYPGQKLYIPKFEKISEKVYE

Enzyme Prediction     

No EC number prediction in MGYG000000857_00997.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	461	504	2.4e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	2.37e-13	459	503	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	9.22e-12	461	504	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	2.42e-11	460	503	1	44	Lysin motif.
pfam12673	DUF3794	3.64e-10	36	118	1	80	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.
pfam12673	DUF3794	8.43e-10	189	265	4	79	Domain of unknown function (DUF3794). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, and is approximately 90 amino acids in length. The family is found in association with pfam01476.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOT70189.1	8.46e-64	2	505	3	518
AUS98467.1	4.46e-62	2	505	3	519
AEV66791.1	2.49e-60	2	510	3	523
QEK13278.1	3.55e-60	2	505	3	518
QXM06792.1	6.90e-60	2	505	3	518

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000857_00997.