CAZyme Information: MGYG000000857_01354

Basic Information

• Species: CAG-269 sp900552555
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp900552555
• CAZyme ID: MGYG000000857_01354
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		49020.11	7.9275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000857	1764654	MAG	China	Asia

• Gene Location: Start: 31577; End: 32848 Strand: -

Full Sequence      

MDYVYILREALVWIITIFWLYQVLVSVCSLVKIKEKPLKNKKTNKFMAIIPAHNEEAVVG
NLIESLKNQDYDKDAYDIYVIADNCTDRTARIAREAGAIVYERYDETKKTKGYALDWFLQ
QKIKEDAPYDAICIFDADNIVDKNFLKAMNKKLCQGEEVVQGYRDIKNPTDNWITSGYAL
FYWTMHKFYHLARYNLGLSPLLNGTGFMVSFNIIKENGGWKTVTLTEDIEFSLQRILKGK
RLGWATDAIVYDEQPTGFAQSWSQRSRWTVGHMQCMKEYTGKLAEAAKEKKTMMNFDGFL
YIIGSIPMFILTLLLLVSNFVLYAMDGMTQTELVINILRYLVPTFVLPSLTAAFVMWIDG
KPIKPMIKGLFTYPLFMGSWLLINFKCLFKRDTNWEKITHNRSIKIDDVSENIEDTVKEV
EKV

Enzyme Prediction     

No EC number prediction in MGYG000000857_01354.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	271	3.3e-27	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	8.66e-91	49	231	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	7.17e-52	49	228	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	5.55e-48	3	391	13	372	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	1.49e-25	45	274	2	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam13641	Glyco_tranf_2_3	4.77e-23	46	268	4	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDZ24461.1	1.95e-107	16	409	19	409
BCI60981.1	4.55e-106	6	411	10	415
QWT55360.1	1.12e-102	20	410	23	414
AUN03940.1	1.71e-99	9	409	13	420
AXG93862.1	1.71e-99	9	409	13	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.08e-19	41	301	46	306	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
P74165	1.02e-14	49	279	113	343	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
Q8YMK0	9.94e-14	49	279	111	341	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	4.19e-13	49	279	111	341	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q5HCN1	9.54e-06	49	271	52	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
192	214
300	322
335	357
367	389