CAZyme Information: MGYG000000859_00146

Basic Information

• Species: Faecalimonas sp900546325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp900546325
• CAZyme ID: MGYG000000859_00146
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	MGYG000000859_1|CGC1	45749.75	5.0445

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000859	2911374	MAG	China	Asia

• Gene Location: Start: 155481; End: 156695 Strand: -

Full Sequence      

MKTDTVKREKLNVGMIGFGARGTWLLQDVILPLEKANVRAVCDSYEDRAVKAADKVEEVQ
GTRPAVTMDYQEVIANPEVDTVIITCAWEDHISIAIEAMRAGKAVGMEVGGAYTVEQCWD
LVRAYEETKTPIMMLENCCYGRREMMAMHMAELGVFGTVVHCKGGYHHDLRDEVSGGEKY
RHYRLRNYLNRNCENYPTHELGPIAQLLHINHGNRMVSLTSTSSKAAGLHEYITDRLGED
HALANAAFAQGDVVTTVIRCAGGETITLTLDTTLPRYYSRDFTVRGTKGMYEEVTDSVFL
DKQHEEYDFKWKEQWGNAEEYSKEYEHPMWKQYKEEGVRGSHDGMDWLVFREFFDSVLNG
TPCPIDVYDTAAWMCITALSEESILAGGRPVMIPDFTKGAWTTR

Enzyme Prediction     

No EC number prediction in MGYG000000859_00146.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	8	403	4.3e-145	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.97e-17	10	395	3	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.41e-11	11	134	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	0.001	13	107	20	131	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
COG1712	COG1712	0.002	11	110	1	93	Predicted dinucleotide-utilizing enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	2.99e-197	9	404	2	398
QIB57148.1	1.07e-194	9	401	2	389
QMW80076.1	1.07e-194	9	401	2	389
QBE96673.1	1.07e-194	9	401	2	389
QTH43530.1	6.77e-187	8	404	2	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.09e-95	9	401	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	2.45e-61	10	403	42	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	3.39e-07	11	127	24	136	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	1.69e-94	9	401	19	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A4Q8G1	1.05e-89	11	404	53	462	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	3.46e-87	10	404	49	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
B2FLK4	1.38e-86	10	404	33	444	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
Q01S58	4.42e-77	11	404	43	435	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000859_00146.