CAZyme Information: MGYG000000859_02250

Basic Information

• Species: Faecalimonas sp900546325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp900546325
• CAZyme ID: MGYG000000859_02250
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
582	MGYG000000859_39|CGC1	67410.69	4.6629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000859	2911374	MAG	China	Asia

• Gene Location: Start: 2626; End: 4374 Strand: -

Full Sequence      

MKTPEIKKTDNMNVTIETAEREKQVFVFKCCFTADGSAEEEKGFSELTWVFPYLDCAGVW
HPNCGFDRSIDADWAGYFRSMTASSAPVMTLFSEDGRNRYTVAVSEAKEIMEIRAGIHEE
DGTVLLQVKVPNTYVTRTGSYEMEVLIDQRDIPFYESIAAISKWWETDCGLTPINPAEAT
REPVYSTWYSYHQNLTDKEIEKECKLASEIGFKTVILDDGWQTDDNNRGYAFCGDWEVSK
NRFPDFRGHIEKIHDMGMKYMIWYSVPFLGYKAEKWDEFKDRTLYYMDSMGAGVLDPRYP
EVRAYLVNTYVDGMKKWNLDGFKLDFIDQIVETKDTPAYQEGMDFGSVQEALDCLMIQIY
EAISKEDPEVMVEFRQRYIGPNMRRYGNMFRVTDCPNSAIRNRVGTVDLRMLSGSTTVHS
DPLMWHIKEKPELAAIQIISSIFSTVQISVKLEESTEEMKKMLRFWVDFMREHKDLLQKE
QLRPQEPHNLYPVVWSVSEKQAVGAVYTENRVIALPKEVNEYMILNGTKGKRMILESELE
GIYEIVVKDCKGEETDRLTYEGRLELFSVEVPVAGQIYLVRK

Enzyme Prediction     

No EC number prediction in MGYG000000859_02250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	176	510	1.8e-33	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	6.11e-69	181	472	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	9.33e-19	181	339	1	160	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	7.87e-12	187	269	298	379	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	3.59e-11	171	479	31	346	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	2.51e-09	185	394	5	179	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31288.1	0.0	6	582	7	586
QJU17504.1	2.27e-181	32	582	39	587
QOV11148.1	2.72e-169	46	552	48	558
CQR57728.1	2.51e-166	46	579	52	587
AIQ22829.1	4.36e-166	15	581	12	575

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000859_02250.