CAZyme Information: MGYG000000859_02262

Basic Information

• Species: Faecalimonas sp900546325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp900546325
• CAZyme ID: MGYG000000859_02262
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000000859_39|CGC2	83087.14	4.6424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000859	2911374	MAG	China	Asia

• Gene Location: Start: 18831; End: 21083 Strand: -

Full Sequence      

MDVKALVAKMTLEEKAGLCSGQDFWHTKAVERLQIPAMMVSDGPHGLRKQDESGDHLGIN
DSIKAVCFPAGCATASSFDRELLYKIGETLGNECQAEGVGVILGPAVNIKRSPLCGRNFE
YFSEDPYLASEIAASQIKGVQSRQVGTSIKHFLANNQEHRRMSSSSEVDERTLREIYLSA
FEGAVTQAKPWTVMCSYNKINGTYAAENKTYLTEVLRDEWGFDGFVVSDWGAVNDRVPDL
EAGLDLEMPTSFGLNDKKIVEAVKAGTLSEEVLDKAAERILNIVYRFEENRDTTAVFDRE
ADHEFARKAASECMVLLKNEGVLPLAKEKKAAFLGAFAEKPRYQGGGSSHINSFKTESAL
EMAAEYPVVYAKGYDTKEDKIDEKLVAEAVNAAREAEVAIIFAGLPDAFESEGYDRQHMR
LPECQNHLIQEICKVNENVVVVLHNGSPVEMPWADQVKGILEVYLGGQAVGGATVDVLYG
KVNPSGHLAETFPVKLQDNPSYLSYVGEGNKVEYREGVFVGYRYYDTKEMDVLFPFGHGL
SYTTFAYSNMKLDKTEMDDTDTLTVQVDVTNTGDCFGKEVVQLYVMPPKGNVIRPVKELK
GFEKIGLEPKETKTVTFTLEKRAFAYYDTDLQAWNVESGSYQIALGQSSRTILAKQEVEI
RSTTEKRPELNMDTTFGDIMEIPGAKEVMAEFAGALSIFGQMEGDTLGEGTGDMMEAMMR
YMPLRGLIAFGGGKLTFEDTEKLLERLKKL

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	249	5.6e-70	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.43e-105	3	652	38	757	beta-glucosidase BglX.
COG1472	BglX	1.48e-71	22	349	47	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	2.50e-66	314	522	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	2.65e-60	4	620	54	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	9.93e-42	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18561.1	0.0	1	750	1	758
QHQ63232.1	0.0	3	749	6	755
QUC66582.1	0.0	1	749	1	754
ASU30988.1	0.0	2	748	4	753
ANU78179.1	0.0	2	748	4	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.46e-309	1	750	3	754	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.35e-211	7	734	9	733	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	7.52e-138	3	668	4	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.03e-137	2	660	5	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X42_A	1.16e-136	3	668	4	721	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.63e-309	1	750	3	754	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.72e-202	7	735	9	744	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	4.85e-202	7	735	9	744	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
Q5BB53	6.51e-153	1	663	4	833	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
A1CA51	1.51e-150	2	663	5	832	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000859_02262.