CAZyme Information: MGYG000000859_02422

Basic Information

• Species: Faecalimonas sp900546325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Faecalimonas; Faecalimonas sp900546325
• CAZyme ID: MGYG000000859_02422
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1369	MGYG000000859_46|CGC1	152490.82	4.4216

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000859	2911374	MAG	China	Asia

• Gene Location: Start: 2178; End: 6287 Strand: +

Full Sequence      

MSDINQEMTPHPGPDGKKEGFCGQLKAVRAVEKGEERHIVWITFGEDLKGKLTFLEENIF
RYDVDPSGAFESYAAPREKEHTAKIQQCPDESDFYTKPEVEICEGDQTIKICCGKTEVMF
EKETAKMKVCINGKAVLEEAEALTVGEETIQVLVKREHENFYGGGTQNGRFVHTGKTIQI
VNESAWMDGGVASPNPFYFTTGGYGVLRNTFADGSYDFGESEAEIVRAGHKEEKFSAYYF
LSDGENGSRITQELLKAYYHVTGNPLLLPEYGFYEGHLNCYNRDAWSEKAGDKEWNIKGT
AESTAEGITRYESGMATGYRLSEGQHSESLNGEGPTVAAEHYPQNADTPYEYSARAVLDQ
YVRYDMPLGYFLPNDGYGGGYGQNGYYVQGGVNEDGSSSPERIAAVDANVENLAKFREYA
NGKGVAAGLWTESNLAPDSDNQTYWHLLRDFRKEVSVGGATTLKTDVAWVGPGYSFQLNG
VKTAYDIITTAEQFRPNIISLDGWAGSQRFNSVWSGDQTGGNWEYIRFHIPTYIGSSLSG
NPNIGSDMDGIFGGKALIAARDYQWKSFTPQMLNMDGWGTYMKAPYTFGDPYTGINRMYM
KIKSKLMPYIYTTAVSASNLDTGNDDTGLPIVRAMFLEYPEDTYAYSRTMQYQFLLGANI
LVAPVYKNTAADEEGNDVRNHIYLPDENEVWIDYLTGEKYPGGQVLNNFAAPLWKLPVFV
KNGTILPMYEANNTPDAIDRTKRIVEFWPGGDSSYTTYEDDGKYIHNQTEEDEAYGTIDH
VSYGSHVATTYTSHVEGEKAVLTAECSEGTYEGYDAERSTTFIVHLSKRPETVLAYNGES
SLCLTEAGDLETFEQNVPKQGEAVFFYDEHPVLCTYASEEEKHFRAMVKEAKIAPKLYVK
LAAVDSQKERQTVEIQGFENAVHRMPEKENTALVVPQLTAAEEEKTSTSIGLRWTESEGA
AVYEMLVDGNLYTMGEALSYIHDDLEYHSEHTYSVRARNENGYSAWSEPLMTSSLLDPWR
NEIGALGTITWTGGDDAGALKYATDHSFRGLFFSVGDIVGDKTPFIYDFGAAYELDRFEY
YPRDSYGSGTVEQMNVYSSLDGKHWKLEWDGTKEEEWTYNTDLEVEENAKTVPLAGVSAR
YLKLQIMKSRRNYFASHELPVYKKDGSKPFAVGSTNKNETVSEGDYTNMKNYLGTSVKDG
SNFVDQIQKRSGDVNMNGIYDVYDYAFTMFKLDGGTKQSGEVSGQARLCTEKECVKAGES
FTLTVLAEDAKNVNAFGSVIDYDPSHLEFVSAVGTGAAGEMEDLTVNKVYSDGTAYVNLA
FANRGDKPLYHGSDELAVITMKALTDLCPAEEMKQDEILLIGPAYDVAE

Enzyme Prediction     

No EC number prediction in MGYG000000859_02422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	252	726	1.1e-53	0.9765807962529274

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	1.96e-141	261	697	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	2.55e-57	156	798	150	741	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	3.23e-51	495	726	230	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	8.20e-39	495	730	213	430	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
cd08759	Type_III_cohesin_like	1.32e-28	1244	1347	1	106	Cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents type III cohesins and closely related domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO30799.1	0.0	1	1368	1	1369
BBK61154.1	0.0	17	1369	31	1429
BCT46261.1	0.0	25	1365	43	1380
QWT17625.1	0.0	21	1369	46	1410
QNM10857.1	0.0	20	1369	26	1365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	1.29e-235	27	1020	39	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	7.16e-235	27	1020	39	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	2.00e-234	27	1020	39	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6JR8_A	2.54e-27	504	835	474	786	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
6JR6_A	2.54e-27	504	835	474	786	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	1.07e-31	51	812	48	746	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9P999	2.58e-27	470	762	376	658	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9FN05	2.50e-25	357	768	436	832	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
P79403	2.57e-25	414	769	507	856	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
Q8BHN3	4.63e-23	414	772	507	859	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000859_02422.