CAZyme Information: MGYG000000861_00065

Basic Information

• Species: Olsenella_B sp900548775
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900548775
• CAZyme ID: MGYG000000861_00065
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
928	MGYG000000861_1|CGC3	99600.53	4.1314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000861	2145101	MAG	China	Asia

• Gene Location: Start: 68735; End: 71521 Strand: -

Full Sequence      

MRDVTRRQALGFAASALAAFAQAGCAATQPQEGGEGAEKVRSVQSVEALDASVTAGWNSA
YYTPAYGSLDEAVLASHEVARTIEAEGVVLLANNGVLPLTEGCAVSLLGRSAEDPLFGGY
GAGSVAADAVCTGFYDGLVEGGLEVNPTVHEWLSAHAQDRPRGGIQTLDVRATTTYYIGE
LPWSSYPEDVRASVSETVAVVVLGRASGEGYDLSLDLNAALADERFSSFVPNEETANYAE
GQHSLQLTAEELSLIAGARETADHVVVLLNTGTTLEVGPLVEEGSPYQVDALLHVGFPGA
VGAEVVGELLCGRRNPCGRTCDLWARDMRLSPSFNTMGEHLYTDIHDFYPGNETTGDGAR
FVEYLEGIYVGYRYFETAAAMGAIDYDGAVTFPFGYGLSYTSFSWSLLDCRLDGEDVMLS
ARVTNSGKLSGKDVVEAYVSAPWDGSVEKSAVALVAFAKTSELAPGESQTLELSWPVRQM
ASWSAADGCWALAAGSYQVSLRTDSHHVVEARTLDLDEKRYQTDDATGADVFARFSDLDE
YFDDQAPAAGGGAPVLLTRNDMAGSFPVPARDKTAASVGVTLSMYDAEAEDDGATTVPEI
GAENGVSLIDLRGRDFDDPLWDMLLDQLSPGDMVALVCTNAGEKIDSVGKPATDWDDSPV
AMGGMERGGSHCVWPSEYLVAETWDVDLLRSMGEAVGEESLSSGIFGWWSPAINMHRSPF
SGRNYEYYSEDPLLTGSLARAMLDGGASRGMVNILKHFCVYDQETGRREHLCTWATEQAV
REIYARPFEMVVKSPMRNAVPVLDVSTGEQTQAEVNVPLSIMSCYSFLGNTWGGGREDLQ
TGLLRDEWGFDGVVLSDFSVDDYYMDHDQGIAAGTDLMLATAATGTVADPRSAHTLNNLR
RSVHRYLYVVVNSNAMNGISPTVRVTYS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	663	879	6.5e-45	0.9074074074074074

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	8.41e-28	673	881	82	280	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.98e-24	663	879	77	283	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	1.46e-18	80	512	387	761	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	3.25e-16	88	372	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	4.12e-14	433	505	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK68812.1	3.06e-256	51	927	55	932
QOY60941.1	2.84e-252	57	927	72	942
QGQ20929.1	9.91e-211	54	928	52	924
QOL32307.1	1.05e-208	57	921	72	924
SQH20118.1	6.76e-207	56	928	54	930

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	1.46e-70	78	858	38	748	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X42_A	1.87e-38	78	520	326	717	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
2X40_A	1.87e-38	78	520	326	717	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.29e-23	674	910	70	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.69e-23	680	884	77	256	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	5.43e-75	78	916	11	768	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	1.01e-69	57	884	4	793	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q5BFG8	1.87e-28	649	877	42	247	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P27034	6.52e-27	622	877	3	239	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
E7CY69	8.41e-25	653	879	60	249	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	0.000013	0.000084	0.999896	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000861_00065.