CAZyme Information: MGYG000000861_00700

Basic Information

• Species: Olsenella_B sp900548775
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900548775
• CAZyme ID: MGYG000000861_00700
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39493.87	6.5036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000861	2145101	MAG	China	Asia

• Gene Location: Start: 19062; End: 20120 Strand: +

Full Sequence      

MAENALHGVNLTGWLTLEPWVTPELFSGSGALDEPSLVTSLGARGYREVVRRHRARFVTR
DDFSRIASRGFNAVRLPIPWYVFGEGGPNPGPYLGCIEDVDQALEWAEEIDLKVVFVLAV
NPGVPGDEQTWNNFTDERGIRENSLWVLSQLGSRYASRMGFFGIEVADDARIQTRRGLGV
TDGLPGHLLRNYYRAAYDRVREAAGPDPVVILPDAGIPTDWRRFMAQRQYQNVWLDCHLD
KPSAIMANMGYAPVANTLGLRRIMAEIHRHIREDQKSGLPVMVGKWSSALPIADAAMTPE
GRVALERIYSSEQLTAYEKLPAWFFQTWKTTGRLSSWDARVALSSFERGLIC

Enzyme Prediction     

No EC number prediction in MGYG000000861_00700.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	331	1.7e-41	0.9668874172185431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.38e-11	6	226	18	239	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.47e-05	57	216	24	169	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY61077.1	1.93e-160	1	351	1	346
ADK68544.1	3.50e-144	1	351	1	346
SDR87855.1	7.67e-141	1	351	1	346
AKT48931.1	8.74e-135	1	351	1	345
ACV51516.1	3.32e-132	1	351	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	3.25e-36	6	329	3	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	6.28e-36	6	329	3	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
3N9K_A	2.07e-19	3	330	11	366	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
1EQP_A	9.18e-19	3	330	6	361	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	1.25e-18	3	330	6	361	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XN12	3.59e-32	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	3.47e-31	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A1D4Q5	6.62e-31	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1
A2RAR6	1.21e-29	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q5B5X8	2.72e-29	6	345	29	387	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000861_00700.