CAZyme Information: MGYG000000861_01293

Basic Information

• Species: Olsenella_B sp900548775
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900548775
• CAZyme ID: MGYG000000861_01293
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000000861_28|CGC1	23711.77	7.8266

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000861	2145101	MAG	China	Asia

• Gene Location: Start: 16886; End: 17533 Strand: +

Full Sequence      

MSARSRRGRGAKPRRRRGRRRGQSFWRWYRVVPLVLVGAVLIACAILAATPTTLARKALY
PVSHANDIQDSAERHGVDPLLVAAVIKCESDWDENAQSSAGALGLMQVMPQTSSELARMG
LVDSGTYDPENLLDPATNIEYGTAYLAFLGKNLSSTDQVIAAYNAGMGKVEEWLAQPGEL
ADNITYSETREYLRRVSEAYQGYRDSYPNGLLVDQ

Enzyme Prediction     

No EC number prediction in MGYG000000861_01293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	73	203	1.6e-29	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.96e-55	61	201	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.72e-48	59	204	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	6.29e-35	79	201	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	5.29e-32	67	201	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
pfam01464	SLT	7.53e-31	68	184	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK68420.1	1.30e-75	21	211	2	192
SDR81479.1	5.44e-75	25	211	6	192
QOY61251.1	1.28e-71	14	213	5	205
AKT50021.1	7.24e-58	49	212	17	180
QPR42159.1	9.51e-56	25	211	6	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	3.97e-17	84	203	473	597	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	1.34e-16	84	203	473	597	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5O1J_A	2.42e-16	56	196	408	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5MPQ_A	2.42e-16	56	196	404	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	2.43e-16	56	196	414	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.48e-19	68	200	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC4	7.45e-16	84	203	500	624	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	7.45e-16	84	203	500	624	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
B7LPT3	1.50e-15	68	204	196	357	Membrane-bound lytic murein transglycosylase C OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=mltC PE=3 SV=1
O64046	1.65e-15	60	200	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988634	0.008092	0.001499	0.000052	0.000025	0.001700

TMHMM  Annotations     

start	end
28	50