CAZyme Information: MGYG000000861_01717

Basic Information

• Species: Olsenella_B sp900548775
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900548775
• CAZyme ID: MGYG000000861_01717
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315	MGYG000000861_59|CGC1	35421.48	4.8374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000861	2145101	MAG	China	Asia

• Gene Location: Start: 9423; End: 10370 Strand: -

Full Sequence      

MLSDVLGLADIPAARDQLYCDKDSINFMKGGLCYADALTTVSPSYAYELQMPFYGEGLDP
IFRRRSGILSGILNGIDTTIWNPKTDGMIPANYSPDDLANKAECKRALQEELGLRQDPTR
PLVVMIGRLTNQKGLGLVRYAMDGIMQRGVQVAILGTGDADQEEAFRYFDQKYGDMICAR
IAFDNALSHRMYAGGDILLMPSEFEPCGLSQMIAMRYGTLPLVRETGGLRDSVVPYNKFT
GEGTGFRFSNMNADEMADTLLGACEIFWTNQELWTKLMLQAMATDFSWRRAANDYMDIYH
GLHPEVIRYNKRRDR

Enzyme Prediction     

No EC number prediction in MGYG000000861_01717.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	9	300	1.5e-114	0.6122881355932204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00654	glgA	2.80e-153	4	302	165	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.08e-152	23	301	197	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	2.62e-134	23	302	194	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	1.16e-124	6	302	181	478	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	9.02e-97	24	302	199	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY60573.1	3.74e-189	1	315	185	499
ADK68794.1	7.54e-178	1	309	184	492
AKT48088.1	7.88e-176	1	313	184	496
QUC03508.1	2.14e-172	1	306	187	492
SDS02040.1	1.21e-166	1	308	184	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QZS_A	3.27e-74	25	305	195	479	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3D1J_A	3.76e-74	25	302	195	476	ChainA, Glycogen synthase [Escherichia coli]
3COP_A	2.55e-73	25	305	195	479	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
4HLN_A	1.02e-70	14	299	334	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
1RZU_A	1.06e-59	23	302	195	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	6.76e-94	2	302	178	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A6M334	2.21e-92	23	302	197	475	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
Q18A79	1.80e-91	24	302	201	478	Glycogen synthase OS=Clostridioides difficile (strain 630) OX=272563 GN=glgA PE=3 SV=1
Q8CWX0	4.55e-91	1	302	175	475	Glycogen synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=glgA PE=3 SV=1
A8AYH0	2.56e-90	22	302	195	475	Glycogen synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288) OX=467705 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999953	0.000107	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000861_01717.