CAZyme Information: MGYG000000862_00152

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000000862_00152
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000000862_1|CGC2	53995.75	4.5652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000862	2326547	MAG	China	Asia

• Gene Location: Start: 181630; End: 183078 Strand: +

Full Sequence      

MAFPDGFLWGGATAANQCEGGYNEDGKGLGVPDIMTGGTVSEPRHITDGILPQYHYPSHE
AVDMYHHYLDDIKLFGEMGFKCYRMSINWSRIFPNGDEAEPNQAGIEFYRRVFQACQEQG
IEPMVTLSHYELPYGLSKNYGGWKNPKLIDFYLNYARTVMTEYKGLVRYWLTFNEINCLL
MGGFGGVMGGGMVPEATDTPMAFGDCDWDDPQARFDALHHQFLASAKCVTMGHQIDPQNK
IGCMIAGNACYPHTCNPADVLAAQKQQREMNFYCGDVQVRGAYPSWAPSVWRREGVHVEV
SPEDAATLAAGKVDFYSFSYYMSATATADPVLLEQGNIFGGAGNEYLKKSDWGWAIDPEG
LRYYLEEVYDRYQVPLMIVENGLGAVDEVEADGAIHDGYRIDYLREHIKQMEIAIEDGVD
LMGYTMWGCIDLVSASTGEMKKRYGFIYVDKDNDGNGTLARSRKDSFFWYKKVIATNGAD
LA

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	478	6e-149	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	481	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	482	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	481	4	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	480	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	481	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54745.1	0.0	1	482	1	482
BCJ92912.1	6.61e-225	1	482	1	481
QLY79850.1	1.03e-221	1	481	1	480
BCZ48952.1	7.73e-218	3	481	9	486
AGF59117.1	1.56e-217	1	481	7	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	9.71e-182	3	481	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	2.33e-175	4	481	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	6.64e-175	4	481	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3QOM_A	5.58e-174	2	481	10	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	2.25e-170	1	481	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	3.28e-177	3	481	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	9.04e-171	3	481	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46829	1.23e-169	1	481	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	1.63e-168	1	481	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	1.63e-167	4	481	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000862_00152.