CAZyme Information: MGYG000000863_00390

Basic Information

• Species: UMGS1490 sp900547395
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900547395
• CAZyme ID: MGYG000000863_00390
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1181		133028.58	6.6946

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000863	2015892	MAG	United States	North America

• Gene Location: Start: 130503; End: 134048 Strand: +

Full Sequence      

MKTLKSALIAWICLAAAFAFADTRHVRKLEGEGWNLWLDRDAKYQDDTLYINKSDIQKIK
DGKPDWLKQVDVKEMKAAEPTCGWENLFSKTADWREAEKAWKDKSISLKVSVPSTVEEYF
FDAISGKNMGKGASGDYRGVSWWGRKFNIPAEAKGRRVKLLFKEGVRHRAEVFVNRKLAG
YELVLQSPFEIDITDIVNYGAENELAVRITDANGNFSWGDYIFAKWGKYQFPLSHGFGGI
MGGVDVVMENDIHVSNIFVKNKFALRDIDTLVEIANDSNSPKTIFAEAEVIENWIDGKKA
AKPKTIFSAGIGKFEIPANSSKIVEFNAFVESAKLWDIGNSNLYDMKITLKDENGKILDS
FSDRFGFRFFEARGIGNDAKFYLNGRRVFLLSAISWSFWPCNGMIPTKELARKHVESAKK
LGMNMINFHRSRGNHEVLNAADELGVLYYEEPGGFSTYRVKGQNMDGVDTSIAHEICRQK
LLRMVKDHRNHPSLVIYNMVNEPGWQPDDLAKEAMSAAHMLDPTRFISYGSGFMGMKNSE
PIKLHMLPYDPKQYTVGYCDIHNAGNSPGVYVDSNYNSPTGFLRNERDETEIFVWGEEGA
LATPPQLELIQEEKKGKPNGWDGQEYDAWYNGYKNYIEEKGLKQNFPSITKLITSMGDIM
YYEHGRLLENARIADGAEIYVLNGYEDMKDDNLSGAVDCYRNLKGSPELIANHMKPLAVA
VKAREKLAHVGDVNIFDLFVLNENVLPAGEYGITASVRTPKGAERKIHNGTARVSGGEKF
SDLACENLKVELNDGAGHYIITAELFDRDGKRIATGKDEMFAIDYKSGEIKSKGAIVGGG
GEYARFANDILKADLKPYSENMGRLDYILLAPTDQGKMFKTISPFNFRSKDGKNIGLNLD
YYRGKKFDMPLDKRISTAPIDFNLKSKLIPGYDILGTVDFSLRWEGFVISDYTGKVEFEF
ACDDGARVWFDGELVFDKWSNGPKTVRTFSREMQAGKMYSIKIEAYQDGGDWLSSLKWKL
PVPETKVDLNALLKRVFEDGTKLILIEGAEEWLKELKNLGAFPEYQVFHPHKTWVGHNMF
VKDHPFFDGLPVNCGMNWEYQSLVVYDGPKHFGLVMKGEEPLVGLVGVPLRGIATSVGMV
NYGKGKIVFSSLDIAPNLAVDTKPSNTPKKIFSNILKWAEK

Enzyme Prediction     

No EC number prediction in MGYG000000863_00390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	88	561	5.3e-69	0.5039893617021277

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.96e-26	142	533	66	435	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	3.71e-20	136	529	62	447	beta-D-glucuronidase; Provisional
pfam07691	PA14	2.78e-18	896	1021	4	130	PA14 domain. This domain forms an insert in bacterial beta-glucosidases and is found in other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium prespore-cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal structure of PA shows that this domain (named PA14 after its location in the PA20 pro-peptide) has a beta-barrel structure. The PA14 domain sequence suggests a binding function, rather than a catalytic role. The PA14 domain distribution is compatible with carbohydrate binding.
smart00758	PA14	9.10e-18	896	1021	2	126	domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
PRK10340	ebgA	7.52e-17	145	529	115	474	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT88121.1	9.90e-213	12	1179	14	1130
QDO68997.1	2.07e-212	22	1179	21	1128
ALJ60861.1	7.67e-212	12	1179	14	1130
QRQ50392.1	1.75e-210	22	1179	11	1118
QUT46481.1	3.45e-210	13	1179	9	1130

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ED1_A	1.12e-26	138	525	76	447	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6ECA_A	8.19e-21	108	523	70	463	Lactobacillusrhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]
6D1P_A	2.93e-18	137	525	86	461	Apostructure of Bacteroides uniformis beta-glucuronidase 3 [Bacteroides uniformis str. 3978 T3 ii],6D1P_B Apo structure of Bacteroides uniformis beta-glucuronidase 3 [Bacteroides uniformis str. 3978 T3 ii]
3CMG_A	1.61e-17	122	525	38	421	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	1.65e-17	122	525	57	440	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	7.29e-29	92	525	58	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	2.64e-23	136	525	53	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	9.85e-20	164	525	78	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KN75	1.91e-15	110	540	58	469	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P06864	1.16e-13	145	529	115	474	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.999122	0.000166	0.000159	0.000146	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000863_00390.