CAZyme Information: MGYG000000863_00741

Basic Information

• Species: UMGS1490 sp900547395
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900547395
• CAZyme ID: MGYG000000863_00741
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		46548.85	10.0847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000863	2015892	MAG	United States	North America

• Gene Location: Start: 47286; End: 48539 Strand: +

Full Sequence      

MAVLMPYYAMRMIKRGGYGKDFSHRFGFLKNLSFPEKGKKRIWIQAVSVGEVEALSSMLK
LLHEDGGFEVVVTTTTSTGYKILREKYAKYCYYVGIFPFDFWLSNALAWRRIKPDMCVQM
EGELWPEHLHRAKSKKKPLLLLNARLSDRSFKRYSKAGFFARRIFNKFDAIACGSEFDAA
RFLKLGAKPEIVSSTGNIKFDASNSAPLSESERDALKSEMGFENDSLVLLGSSTWAGEEE
MLLEALSEIRQKTGIDARLLLVPRHAERREEVRRLLQGGVLPFNFRTEKQNAPGGTLVYV
ADTTGELARLTQVADFAYAGKSMPPNDGGQSPLDCAAAGVAIVYGPNMTNFKKMCESLEE
AKASIKVSDKKNAKDALLKLAKDVALRKQIGLNALNWHHANSGASVRAFALIKKFSK

Enzyme Prediction     

No EC number prediction in MGYG000000863_00741.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	22	202	3.6e-53	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	2.83e-88	3	415	16	420	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	2.30e-80	6	415	18	418	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	6.40e-44	25	202	3	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
cd03794	GT4_WbuB-like	0.007	79	394	88	373	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY36206.1	8.08e-131	5	414	17	429
ADE56009.1	8.13e-118	5	407	17	418
SDR67662.1	1.36e-111	6	413	26	429
ACB75815.1	8.44e-108	1	414	13	422
AOS45219.1	1.27e-106	1	414	13	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BFC_A	1.36e-10	223	415	40	230	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC77	4.53e-49	3	415	12	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC75	4.53e-49	3	415	12	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P0AC76	4.53e-49	3	415	12	419	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P44806	1.41e-37	3	415	16	422	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q45374	3.07e-32	42	407	55	418	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000863_00741.