CAZyme Information: MGYG000000863_00752

Basic Information

• Species: UMGS1490 sp900547395
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900547395
• CAZyme ID: MGYG000000863_00752
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1250		142550.41	8.4294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000863	2015892	MAG	United States	North America

• Gene Location: Start: 58634; End: 62386 Strand: +

Full Sequence      

MKKLLFLLLAGGFAFTGSFAKNADFLDSKFVFEDIETFKINKEEPRAFFISYPNFELAAK
PISAADIGKIYDTPNYMLLNGDWKFLFLENEKLFKSEYVSATFDDSKWDILDVPDTWQAK
GYDRIFYNNTTAEFQFHKDGSWIKGYGDDGKENPSEAILNPVIPEEHREVAVYRRDFNLP
ENWNGRAVFIRFNGVRTGFKVFVNGKFAGYAEDSFTPSEFNITPLLKKGKNSVAVEVFKY
STGGFFEMQDMPHMSGIIRDVMLISRPETYIRDYYAPVFFSEDLSSAKIKLETFIKNLSE
KSASGLVLKADIIDEQGNKLNSKTLLEKKIPQIQTSKEIKISADIGAKNFKLWSPDKPNL
YAILITLSDAEGKTLETVRADFAFRKFEVRGTGIFLNNRPVLFKGVNRHDWSPDKGKTCE
FKWQKRDVELMKRININAVRTSHYPNDDTFYMLCSRYGLMVLDECNQEQHGYRNTGPLDF
DKFIPASVDRMRNMVFRDRNIPCVMIFSVGNESAGRIVKGHGEMAKVVRDNAPLHYVHSE
AEVWHKMNGEDKGFSDFASPMYGGVDRMNEYLRKIQKKVPFFFCEYAHAMGNSIGNLKGK
WDLIRTNADCLHGGFIWDWVDQSLYLPREDGSGKLYLSDGRDWKTSPSAGNFCSNGIVRA
DRTFFAKYHEVGRVYQDIQVSRPNGENPKLIKISNEFFDTNLNEFDAKIVVECNGKQVFE
KTLDAIDLPAGKSTEIELDIPEFGGGGEYFYSVVFTRKADTLFAKKGDKVSSTQFKLKGG
EPLKEMKIANRGKIEVSKNGDAVLVKAGNYVYEFDAENACLKSLKRGRDFIITSPVLFDI
STAYIDNERRGEVAREWSGRNLGKLKHIKPSLKIEKQGLNAARITCSEILANNDGEGFAN
EFVYTILPDGTMQVVATCQKINETPRNLNVARIGLKMGLNPKLENVKYFGRGGFANYEDR
KEAADVGLYSLKVKDFMEDYSLPQDTGNREEVRQMKVTDENGLGIIVSAVEKPLPMAILP
YTQEELLSAKHPHNLKEPTQNELRIAWRVRGLGNNACGPSTRNQFKPDFKGAVSWTFVLK
PVSSKAQKADGIFPKQYSYKPLENAENLLVEELMPKPLGRWVSENAKVSYSSIDEKWSPK
KDNLMSSGDGVFSFHTLKERNPHLTVELERAEEIVSVEIVNRADAQGDRTTRLRMFVSEN
GRDWKRVWSCEDYKSKWIVNFENPIRAKYVRLMLDKTEIFHLKRLRIFAK

Enzyme Prediction     

No EC number prediction in MGYG000000863_00752.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	73	964	2.5e-172	0.961436170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	0.0	33	1085	5	1003	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	3.29e-157	78	1037	54	982	beta-galactosidase.
COG3250	LacZ	1.41e-115	79	964	15	804	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.73e-71	387	680	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	3.88e-57	806	1065	1	259	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APC49533.1	6.47e-193	5	1085	11	1048
QKY70370.1	6.16e-182	36	1085	43	1050
AQW26499.1	5.84e-179	27	1086	40	1063
ABG84474.1	1.59e-178	27	1086	40	1063
SQG38637.1	2.21e-178	27	1086	40	1063

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	7.63e-154	76	1055	38	955	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	7.81e-154	76	1055	39	956	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	2.00e-137	40	1082	15	997	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	3.59e-134	40	1082	18	1001	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	3.62e-110	72	1066	45	1008	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	4.28e-153	76	1055	39	956	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	2.06e-147	36	1082	25	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q9K9C6	1.10e-136	34	1055	12	986	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
P06864	1.08e-124	33	1092	5	1010	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
A5F5U6	4.43e-120	75	1055	46	992	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001260	0.997407	0.000707	0.000227	0.000206	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000863_00752.