CAZyme Information: MGYG000000863_01259

Basic Information

• Species: UMGS1490 sp900547395
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900547395
• CAZyme ID: MGYG000000863_01259
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	MGYG000000863_14|CGC1	96669.23	8.4904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000863	2015892	MAG	United States	North America

• Gene Location: Start: 17608; End: 20160 Strand: +

Full Sequence      

MMEKIFVLILLFTLPLSAQVEVANKAGNAFPLISGGNAAQIFVDEDDFESVKKTASLFAS
DLEMATGVKSKVKMESPFGKYAVVIGTLGKNKFIERLIAEKKLDVSKIKGGWEQYLIKTL
ENPANGISKLLVIVGSDRRGASYGVFSVSEACGVSPLYWWADVPVKKSKEIFLKPVNFSS
KSPSVKYRGIFINDEGWGLHRWSRHTFEKESGGIGPKTYEKVCELILRLKGNMLAPAMHP
CTKAFYKFPENKKVADSFGIIITTSHCEPLLFNNATEWQKKTMGEWNYLTNKDGILSVLD
LRVSEAAEYENIYTMGMRGLHDAKMENVEGREVEILEGVMKDQREILSKYIKKPIAEIPQ
IFVPYKETLDIYEKQMNLPDDITLVWPDDNYGYLKRLSNPDEQKRSGGSGIYYHLSYLGG
PHDYLWLCTTSPVLMFEELKKAYDFGADRYWLLNVGDIKPMELGMLSFFDLAWDISKATD
VSVNRYQADWLSKIFGIKYRKDLQFVLEEFYRLSWSRKPEFMGWEREWDAPKWKDILDTD
FSFENYNDAQQRIADYKKIVEISDKIQNSLPEEYKPAFFELAGYPVKASWQMNRKFLMAQ
LNHELAAKKDFAGANWAAEESRAAYNEIEKLNADYNALLGGKWNQMMMLAPGWCAKYHLM
PELSVAENVKPRAVDLAPKKEKSALKGCAVINLKNFKKKIENGNAIRIVEGIGYDKHSIQ
LGNPKEKTADNGLNASRIEYEFNADENAQKLKIHVYTVPFFPVHDGKSTKFGVSVDGGKP
IVFENKFKEFSGRWKDQVLQNGAVEVREIPVKKSRKHTISFICADAGVMIQRVVIDWGGL
KKTYVGPSAN

Enzyme Prediction     

No EC number prediction in MGYG000000863_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	28	832	2.5e-228	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	1.77e-169	181	521	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.58e-24	687	847	7	170	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.002	78	146	48	118	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV07546.1	7.64e-302	19	848	20	961
ALK86808.1	6.73e-298	1	848	2	962
AYD49386.1	5.78e-267	15	848	20	961
APZ45930.1	3.16e-265	6	849	11	956
AUC19792.1	3.16e-265	6	849	11	956

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	5.73e-162	32	835	21	773	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	4.53e-136	2	845	12	844	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
4ZMH_A	8.70e-115	22	644	6	607	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	1.89e-105	30	843	17	827	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	3.60e-105	30	843	16	826	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999107	0.000172	0.000146	0.000143	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000863_01259.