CAZyme Information: MGYG000000863_01533

Basic Information

• Species: UMGS1490 sp900547395
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; CAG-312; UMGS1490; UMGS1490 sp900547395
• CAZyme ID: MGYG000000863_01533
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000000863_19|CGC2	93284.28	8.3819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000863	2015892	MAG	United States	North America

• Gene Location: Start: 46090; End: 48525 Strand: +

Full Sequence      

MKKIFPLLLLLASFPFDTFSQSRLYPQHFDLCEVSLGGGIFKNAMQINNRLLMEYDHNRL
LTPIMRQAGFADWEKRHPNFRNWAEGDFRLDGHIAGHYLSALAFGYASSGDKKMKAELLS
RLNYMVDMIDKAQSTFDGDKSGMYGYAGGMPHNEMWINIYNGNPTFAYKAEGRDFYGAVP
FYVIHKMYAGLRDAYVYAGNKKAKKCFKKLCDWGINLVSNLSDKQLQDLLKIEHGGMNEV
YADAYKIFGEQKYLDAAKRYSQTEFIDGMQTLNRDFLSGKHANTQVPKYIGFERISQLDK
NSEDAGLMSKYNLSARNFWTDVVENRTLSFGGNSVDEHFLHQDQGMRYIERTDGPESCNT
NNMLKLSEMLFDDAHDAKYADFYEKAMLNHILSTQNPRTGGYVYFTSVRPMHYRMYSQVN
KGMWCCVGTGMENHGKYAHFIYTHDKDTLFVNLFVESALKNKKFAVRQTTKFPYEPKSEI
VVEKSGMYSIAVRKPSWCKNFEVFVNGKKSGEETSGYLKITRNWKKGDKISVSMPMELSL
QACPSNEDYVAFTYGPVALGAVVSREELVRQFAEEGRMDHAPGIGKQWNLLDAPILLGDR
EKLLEKIRPCDISKLEFKIDENVYADKKHANLILQPFFKIHEARYMLYWFQPSKERWQEH
KNKMLEIENAKQELEKRTLDFVATGEQQSDAGHVLKGSFGKGEYNGEKYVDSWIGGWFSY
LLERKGKKNVALRMRFTAGDSYRKCTISINGKVFKENFSPVPQNGERGFFEIEMPIPESF
LTESDEVVVKFEANKGTPNPGLYYLRLVEGK

Enzyme Prediction     

No EC number prediction in MGYG000000863_01533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	34	559	1.3e-163	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	3.42e-129	33	559	1	502	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.59e-90	34	567	12	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	1.19e-25	566	649	3	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.
pfam18040	BPA_C	0.001	724	797	8	86	beta porphyranase A C-terminal. This is the C-terminal domain found in Bacteroides plebeius of proteins such as beta-porphyranase A (BPA), a beta-galactanase that cleaves the beta-1,4 glycosidic bond. Porphyranase degrade red seaweed glycans. This domain adopts a beta sandwich shape.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28050.1	2.79e-265	20	808	16	829
QCD36520.1	1.84e-203	20	811	22	788
ASB48769.1	6.64e-202	1	809	1	792
BBE15993.1	4.51e-197	20	808	23	792
QCD43163.1	2.10e-196	3	808	2	784

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.50e-170	20	809	19	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	3.99e-163	20	809	19	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.51e-14	356	627	333	611	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.81e-13	356	627	333	611	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000260	0.999004	0.000215	0.000166	0.000163	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000863_01533.