CAZyme Information: MGYG000000864_01382

Basic Information

• Species: CAG-632 sp900539185
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-632; CAG-632 sp900539185
• CAZyme ID: MGYG000000864_01382
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		40704.28	5.4773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000864	2413963	MAG	United States	North America

• Gene Location: Start: 100711; End: 101748 Strand: +

Full Sequence      

MKIIIASTIVPFINGGGTFIVDWLEQKLKEYGHEAQAIRIPYSSNYNWLLTQDLGLRMYH
LEDACDRLITIRMPAYLIKHPNKYLWFIHHYREFYDLWDTEYNAMPDNVRTYSIREYVKR
SDELAFKEAKKIYTNSKVVSDRLDRYNHVDSEVVYPPLLCDEQFFCEEYGEYIYYSSRIC
GHKRQLLAIEAMKYTKTPVKLVITGKTENDLIAKEIRKIISENDLYKKVIVEDRWIEENE
KVAYLSKCLAAIYIPYDEDSYGYPSLEAHHSEKAVISCSDSGGTSELIVNGYNGYITEPD
PMQLAEIFDHLYENRKLAEQMGRNGKERLNELNISWDYVIRRFTE

Enzyme Prediction     

No EC number prediction in MGYG000000864_01382.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	171	322	5.2e-19	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0438	RfaB	1.53e-21	1	343	1	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	6.56e-19	2	343	1	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03805	GT4_ALG2-like	2.35e-17	123	332	149	382	alpha-1,3/1,6-mannosyltransferase ALG2 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ALG2, a 1,3-mannosyltransferase, in yeast catalyzes the mannosylation of Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)-dolichol diphosphate. A deficiency of this enzyme causes an abnormal accumulation of Man1GlcNAc2-PP-dolichol and Man2GlcNAc2-PP-dolichol, which is associated with a type of congenital disorders of glycosylation (CDG), designated CDG-Ii, in humans.
pfam00534	Glycos_transf_1	4.12e-17	171	328	3	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03808	GT4_CapM-like	5.07e-15	177	342	196	356	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXI39401.1	3.41e-130	1	342	2	343
AVT82954.1	8.33e-116	1	344	1	344
BAL22591.1	1.36e-114	1	342	1	342
SDU11930.1	2.45e-112	1	342	1	341
AKE04423.1	4.92e-112	1	342	1	341

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I45_A	1.78e-08	149	325	6	188	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7KWM5	6.71e-08	204	331	278	402	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Dictyostelium discoideum OX=44689 GN=alg2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999976	0.000088	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000864_01382.