CAZyme Information: MGYG000000866_00341

Basic Information

• Species: Prevotellamassilia sp900556465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900556465
• CAZyme ID: MGYG000000866_00341
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1030	MGYG000000866_9|CGC1	112493.62	5.0145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000866	1503128	MAG	United States	North America

• Gene Location: Start: 12621; End: 15713 Strand: -

Full Sequence      

MRHLYFLLAALFAGLCGARAQLPTFSNGEAEQWYVVQFTTGEAVLQDEGEGQNLKTAALA
GTDPQLWKVTGSAGRLQLAGKSGRYVGYNGSRFYATSDASAASDFELVTNGTSWELKCLD
LGTDGYVYLNQFGGTGAGRELGVWTANDPNNLMRFVVPKEIVEPFPVTGIADYEPEHKNT
LWYDAPVTLASVANPWMEYALPIGNGQLGAMVYGGIAEEQIQFNEKTVWTGNSTTAQRGA
YQNFGNVYIRDVSGVFGPEGGGAVRDYYRQLDLHTATASVHYQSPDRTVSYTREYISSYP
DQVVAMRLTASAPGQISVSVTVDDAAGRTQPAYADGEAHFSGKLTTVSYDCRVKVVPTGG
SLTTDADGITVTGADEVLVVLAGGTDYDPVASTYVSGTARLAATMQARVDDAAELGWAAL
YDRHERDYGALWERAELDFPAAVNNLPTDRLVVQYNKLGLNSPRPETYMLEQLYFAYGRY
LMIASSRGVDLPSNLQGIWNNSAAPPWESDIHSNINVQMNYWPAEPTNLSELHRPFLNYL
YNMAEVQPQWREYARQSGQTTGWTCFTQNNIFGQSNWGENYVVANAWYASHIWQHYRYTL
DRDYLKTKGFPVMLSATKFWMERLIKDRVAGDGTWICPDEYSPEQNNPAVVKQDATAHSQ
QLVWDLFHNTLQAIDVLGLADAGVDQAFVDELTEKFNGLDRGLHTEIYTGAWGATLNGVA
TGDTLLREWKYSGYENGENGHRHLSHLMCLYPLGQVNEGEAAFRAAVNSLKLRGDESTGW
SMGWKINLWARALDGDHARRILKAALKHSTSYATDQYAGGIYYNLFDSHAPFQIDGNFGA
CSGIAEMLLQSHTDTLRLLPALPMLWRNGSMRGLKAAGNFTVDQTWASGALTQAVITSGA
GRDCVVRYAGIAGATVTDAAGAPVACTTSGTDVVRFATQPNGVYTLTMPEEPAGIGSGTT
ADAARWLTTSGRTLTAGAEVVAMEVCDTEGRRWARTTGKKLTVDRGAGHVVIVTLTLQDG
RRPACKLALP

Enzyme Prediction     

EC	3.2.1.63

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	177	911	1.7e-209	0.9847645429362881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	3.93e-52	181	388	1	232	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam03632	Glyco_hydro_65m	7.15e-05	579	690	114	220	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
COG1554	ATH1	1.74e-04	242	647	155	501	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
PRK13807	PRK13807	0.004	588	647	432	489	maltose phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13809.1	5.08e-288	18	1029	110	1131
QFQ12384.1	6.65e-247	18	953	189	1131
BBA29879.1	2.65e-245	22	946	186	1104
QUB64500.1	1.44e-241	22	946	186	1104
QUB60838.1	2.04e-241	22	946	186	1104

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	2.37e-107	193	906	11	752	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	2.06e-106	181	907	24	742	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	5.69e-99	181	910	43	761	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	3.96e-89	181	947	20	895	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	2.69e-88	181	947	20	895	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	5.53e-89	187	893	54	799	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	1.09e-79	180	886	22	756	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	3.68e-64	203	886	46	775	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	5.25e-47	179	899	16	707	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000240	0.999167	0.000158	0.000148	0.000135	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000866_00341.