CAZyme Information: MGYG000000866_00696

Basic Information

• Species: Prevotellamassilia sp900556465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900556465
• CAZyme ID: MGYG000000866_00696
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
956		103177.66	4.4402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000866	1503128	MAG	United States	North America

• Gene Location: Start: 15000; End: 17870 Strand: +

Full Sequence      

MKKVTLLTLLLGLSAVPLSAAPPVRGLWGLAPDRGCHAQAPSGRHGGCCGSRVRQAVVPA
EQADYPVNFDLDETTGNTGRYLTGLTLSGSVDGAQTIAVSHDAPMLLYRPMLDQVFTARA
GERLTPVFGFNGNWMNGYVYLDRGSDGQFSYELNPDYTIPEGSDLMTYSYVMAADGNGGY
ASDGSPLTGDATNVLNPPPFTVPADLAPGYYRMRFKVDWGSVDPGGNTDPTQLIKNNGGE
IVDVRLNVHTDRCPVTLLPAEGGTVTTADGAALSGESFPFGQALQLRVEPAEGYVLDGLV
VRHGYGLDGDSLVHGTPQYVDEVLPAYLVQDGLLTLSAACMDGEVRIAPRFVAAPGGSTA
TEDYPLRFDRDAESDVPVADDATFRLRLMATQGGTTTFTLPTDTPLLYVDQRSRQVSVVP
GDRVTFTLSQTVAPGLSAYFYMDLNQDGQFTPLLDTDGRPTLSGELVSYNYHDGSNSLGE
TVDADAAATADLPAFTLPESLPCGVYRARLKLDSGDLDAAGSASLQALGGRVVDLLINVH
RPTHPLEVVTTNGSVNGSGNTGLPLEVTCFTSLTVVPTPVADGYEAASMTVQHGHNFDGP
QYVHGNRQWSTFSRPAQQVSIPRDSIDGDVRITVHYEPTSEAEYALVFSDEFDAPDGTQP
SDERWMRCPRQSSTWNRWLSDSEAVVYQEGGQLVTHAIPNPDTTTDPVPMITGGVQSQGK
FGFKYGKIEARVLTNPHTGNFPAFWMMPEEQSAGWPACGEIDIFEQIDNENTAYHTVHSH
WTYDLGNKSNPQSSFSETVQMDRYHTYGLEWTEDELTWYVDGRQVGTYAKSTSASTLEQG
QWPFDKAFYIILNQSVGNGSWAANADVSHTYETRFDWVRVYQKSVGPDAVTSPAAVPSLR
VGAERGHIVVEAPAPAEVRVYDLAGRCVSRSTVSGTARIAVMKGLYVVNGQKVLVP

Enzyme Prediction     

No EC number prediction in MGYG000000866_00696.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	649	881	2e-52	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	1.39e-65	648	881	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.31e-31	650	881	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08024	GH16_CCF	7.07e-26	709	857	98	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02178	GH16_beta_agarase	1.98e-24	648	882	25	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
COG2273	BglS	4.57e-24	635	894	40	282	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13169.1	4.23e-99	362	884	23	543
QUB87116.1	1.68e-83	625	952	29	331
QUB75565.1	1.68e-83	637	952	41	331
AKU69476.1	1.68e-83	625	952	29	331
QUB63276.1	6.29e-83	639	952	43	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	2.86e-40	635	882	20	262	ChainAAA, Beta-glycosidase [Bacteroides caccae]
4CRQ_A	2.05e-27	643	883	2	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JH5_A	3.03e-26	715	884	70	234	Structureof Marine bacterial laminarinase [Aquimarina]
2HYK_A	3.18e-26	640	882	3	243	Thecrystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
6JHJ_A	1.90e-25	715	884	70	234	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	9.69e-42	643	882	55	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	2.36e-20	644	882	40	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	1.25e-17	646	883	425	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q8N0N3	7.76e-15	709	857	130	301	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1
C1IE32	4.45e-14	688	857	64	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000241	0.999147	0.000163	0.000154	0.000137	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000866_00696.