CAZyme Information: MGYG000000866_01096

Basic Information

• Species: Prevotellamassilia sp900556465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp900556465
• CAZyme ID: MGYG000000866_01096
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581	MGYG000000866_55|CGC1	64035.96	4.4824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000866	1503128	MAG	United States	North America

• Gene Location: Start: 6767; End: 8512 Strand: -

Full Sequence      

MAKRVKAAWLFQTLTLDDSKGNYVYRDMTQVEVPAKAGDEITTTAVYQGHAMHGYLYVDF
NQDGRFDAQLNADGTPTMAGELLSYTYYSGRNSAGEAITSNPGEVSLASLPAFTLPESLP
EGVYRARFKVDWNNIDPAGQYAEGGSNLINDNGGYIVDFLINVYHDTQKFEVLTENGSVN
GSSNTGLPLYVPCFKSLAVVPTPAIEGFTAEQMTIRHGHNFDGPQYVHGNRQWSEYTVAA
TDYTIPADSLNGDVTLTVNYTVDPATGYKLVFADEFNAADGSQPDAAKWGRCPRQTSTWN
RWLSDSEQVVYLEDGQLVTRAIPNPDTATDPVPMITGGVQTSGKFDFKYGKIEARILTNP
HSGNFPAFWMMPTDQSLGWPFCGEIDIWEQINTQNTAFHTVHSNWTNILGQTENPTSSFN
ETVEMDRYHTYGFEWDETSMRWYVDGKQVGSYAKSTNLTALMLGQWPFDKEFYIILNQSV
GDGSWAAAADESHTYETRFDWVRVYQQTSLPTSMDGAVDAYAGLSVTTSRGQIHLSSAQP
VDVLVSDVAGRVVFSGKVSAPVTVSVSRGVYVVGGRKVIVP

Enzyme Prediction     

No EC number prediction in MGYG000000866_01096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	273	505	6.3e-53	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	4.12e-64	272	505	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	8.45e-29	274	505	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02178	GH16_beta_agarase	3.02e-24	272	506	25	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd02182	GH16_Strep_laminarinase_like	9.31e-23	267	506	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
COG2273	BglS	3.22e-21	257	568	36	317	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13169.1	4.68e-120	13	508	51	543
QUB87116.1	5.64e-83	264	507	44	281
AKU69476.1	5.64e-83	264	507	44	281
QUI93936.1	2.06e-80	267	507	47	281
QUB83835.1	2.29e-79	247	507	27	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JH5_A	1.15e-27	339	510	70	236	Structureof Marine bacterial laminarinase [Aquimarina]
4CRQ_A	3.15e-27	268	507	3	232	Crystalstructure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JHJ_A	7.43e-27	339	510	70	236	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
5WUT_A	2.24e-24	267	506	4	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
6XOF_A	6.31e-24	268	507	24	268	ChainA, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	4.65e-41	240	506	28	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P23903	5.53e-23	211	507	366	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	1.98e-14	347	516	99	268	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
C1IE32	4.55e-13	270	481	22	237	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
O33680	5.59e-10	272	505	222	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000866_01096.