CAZyme Information: MGYG000000867_00312

Basic Information

• Species: UBA1409 sp002338885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp002338885
• CAZyme ID: MGYG000000867_00312
• CAZy Family: GH30
• CAZyme Description: Glucuronoxylanase XynC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	MGYG000000867_4|CGC1	48518.1	4.1857

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000867	1874565	MAG	United States	North America

• Gene Location: Start: 14054; End: 15337 Strand: -

Full Sequence      

MKKILCIVLAAAMLLPLVSCGGMNDELFVPDLSGTAASATVTVDPSEEHQLIRGFGGINY
PTWIADLTEEQRETAFKNGEDQLGFSILRIHVDPDRENWSKELETAKAAVDEGLLVFASP
WNPPAELCEKFNHNGNENAQRLRHDKYAEYAEHLNDFVTYMRDNGVELYAISIQNEPDYA
DGWTWWSTEEIMDFIINYSDMIDCRIMTPESFQYRKDFYDEILNSEEALSKVDIFATHFY
GTQKWDMGYPLFEEKGEGKELWMTEVYVPDSSTDADVWPNALEVAANISDAMTEGNMQAY
VWWYIRRFYGPMKEDGTISKRGYCMAQFSKFVRPGYIRIGATETPADGVSVSAYKGDGKT
VIVAVNESQTSYGQRFEIGGSDELKYIEAYTTSANKSLERIGNVQYDSNEFEYVLEPESV
TTFVITH

Enzyme Prediction     

EC	3.2.1.8	3.2.1.136

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	40	380	2e-138	0.9853801169590644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	5.34e-146	1	424	5	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	7.06e-04	338	423	4	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92717.1	1.45e-171	2	426	6	421
AHA38215.1	4.28e-170	23	424	24	425
QUL57175.1	4.57e-170	2	426	6	421
AGF57038.1	5.30e-169	32	424	25	418
AUZ26615.1	5.49e-169	2	425	6	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GTN_A	4.08e-167	38	425	2	389	CrystalStructure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3GTN_B Crystal Structure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3KL0_A Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_B Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_C Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_D Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL3_A Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_B Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_C Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_D Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL5_A Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_B Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_C Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_D Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis]
4CKQ_A	3.57e-165	39	424	22	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4UQA_A	1.02e-164	39	424	22	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
5A6L_A	2.91e-164	39	424	22	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5A6M_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus ATCC 27405]
4QAW_A	2.76e-159	38	424	1	387	Structureof modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_B Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_C Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_D Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_E Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_F Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_G Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_H Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45070	1.74e-168	2	425	6	420	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	3.18e-164	2	425	6	421	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
G2Q1N4	1.24e-08	37	366	25	410	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000020	1.000028	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000867_00312.