CAZyme Information: MGYG000000867_01381

Basic Information

• Species: UBA1409 sp002338885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp002338885
• CAZyme ID: MGYG000000867_01381
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37153.61	4.2397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000867	1874565	MAG	United States	North America

• Gene Location: Start: 35300; End: 36286 Strand: +

Full Sequence      

MNKFIRAMLAGLILATGLTAGCASNEPQPRKTEFPDNAFQEIPEEYFTEPENAGTVVSIK
YETKNYSGDEEEFEKTAYVYLPYGYNQDDTETKYDVFYLMHGGGGNEKDFFRGVMESSDL
KSIIDNMIANGDMNPCIVVTPSYNNPYNGDATACCKYFANELVNDLIPAVEGKYNTYAEN
VKKSGLKASRMHRAFGGFSMGSACTWWVFEYALDEVGYFMPISGDSWCVENTGGLNKPVE
TAEYMRQIVLDYGYTKDDFYIYCGTGTNDMAYPNMTPMIEEMKKLDDVFVYCDNFKDGNL
YYCIREGGWHDANTIYRIVYNGLPKFFG

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	75	285	6e-28	0.8193832599118943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.12e-12	58	227	66	213	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG42560.1	3.73e-85	31	327	308	602
AEI42872.1	4.41e-84	39	327	336	617
AGA59284.1	7.35e-84	39	327	313	595
AFH62884.1	8.73e-84	39	327	336	617
AEY68182.1	2.61e-83	39	327	404	685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GKL_A	8.42e-63	39	327	24	287	ChainA, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1GKL_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB4_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB4_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB5_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1WB6_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],1WB6_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus]
6FJ4_A	3.82e-57	39	327	10	273	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1GKK_A	5.69e-57	39	327	24	287	ChainA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],1GKK_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],3ZI7_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],3ZI7_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus YS],4BAG_A Chain A, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4BAG_B Chain B, ENDO-1,4-BETA-XYLANASE Y [Acetivibrio thermocellus],4H35_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],4H35_B Chain B, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],5FXM_A Chain A, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_AAA Chain AAA, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus],6Y8G_BBB Chain BBB, Endo-1,4-beta-xylanase Y [Acetivibrio thermocellus]
1JJF_A	2.26e-20	75	314	46	245	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	5.92e-20	75	314	46	245	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P51584	9.53e-57	39	327	812	1075	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
P10478	7.07e-20	2	314	3	264	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EY13	1.06e-09	75	243	514	692	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000054	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000867_01381.