CAZyme Information: MGYG000000867_01648

Basic Information

• Species: UBA1409 sp002338885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UBA1409; UBA1409 sp002338885
• CAZyme ID: MGYG000000867_01648
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41253.08	7.3841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000867	1874565	MAG	United States	North America

• Gene Location: Start: 3299; End: 4393 Strand: -

Full Sequence      

MRLSGCSLCIIAKNEEKTLLRCLESVKGIFDEIIIVDTGSTDGTKLTARRYTDKVYDFEW
VYDFSAARNYAFSKAEYEYAMWLDADDVIPNEYRGALSKTLSELSGDTGAKAKPDMVYME
YCVGFDETGRVTLAYDRERIIRLDCGARFQGAIHEAIPPVGTAARSDAKVYHMGKQNRDK
NRNIEIFERLLKSKKAFSPRERYYYARELSLHGRTLEAVGCYDQCIRDRDCWVENKISAC
CEAAQLWLDAKDRAAAKKYLVKSFEFAPPRADACCMMGYIFLEEGSLDAAKFWYELAPSR
FGKGGGFVPVDCGGYLPYIQLAVVCDRLGDTALANRYNELAGSIKPDSKPYLHNKAYFES
KLKK

Enzyme Prediction     

No EC number prediction in MGYG000000867_01648.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	93	1.8e-19	0.5588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	5.15e-43	7	194	3	190	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
TIGR04195	S_glycosyl_SunS	6.52e-20	10	211	63	266	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
pfam00535	Glycos_transf_2	1.29e-19	7	142	1	136	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	2.72e-18	7	264	6	248	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	9.87e-17	10	143	3	127	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61402.1	1.91e-96	7	363	4	356
QNL44491.1	2.31e-96	7	359	5	353
QBE96567.1	3.28e-95	7	358	5	352
QQR05435.1	1.98e-94	7	360	5	354
ANU41696.1	1.98e-94	7	360	5	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSP_A	7.84e-15	10	219	60	271	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSN_A	1.29e-14	10	219	60	271	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSK_A	4.56e-10	10	209	72	272	ChainA, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1],7MSK_B Chain B, Glyco_trans_2-like domain-containing protein [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31986	7.06e-14	10	219	60	271	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	7.06e-14	10	219	60	271	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
P42460	1.23e-12	7	157	11	150	TPR repeat-containing protein Synpcc7942_0270 OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=Synpcc7942_0270 PE=4 SV=1
P44029	2.19e-10	7	97	5	95	Uncharacterized glycosyltransferase HI_0653 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0653 PE=3 SV=1
Q9R9M9	4.24e-07	10	166	11	167	Lipopolysaccharide core biosynthesis glycosyltransferase LpsC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000867_01648.