CAZyme Information: MGYG000000870_00444

Basic Information

• Species: Akkermansia sp004167605
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp004167605
• CAZyme ID: MGYG000000870_00444
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	MGYG000000870_2|CGC1	61574.49	7.9188

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000870	3134704	MAG	United States	North America

• Gene Location: Start: 32122; End: 33804 Strand: +

Full Sequence      

MIPYLFLFLPAEAVFYFLLHLFLGAPPHPPAAQASVSLPSGYALSWNDEFDGSSLDMEKW
SYRQTGPRHNALNTPEAISTGNGILSIRTYTENGKHHTGMIATKKKSLNRTYGFYEASIE
FAGDRNASSGMWSAFWLQSDTISTVGNTGKYGTEIDIVEYRPNPSNGYETNQAIHYHGYG
EHHKSAAKQHKTGLLEGYHTYGVLRTAGGYTFYMDGKEVWKTQEALSCIPEYIILSSEIR
DKNWAGDIPANGYGSRDKSPTAMNVDYVRVYSLPDSYRTAPDGKWSDRQWETVLPSGRKI
ARLEPPDGANVWFNRERTSSLLLDRDAVVDSLTVGKGKFFHLQGRNKTLAIRSGIAALER
MDLIFDAKMALEGGNVTWTLFEPYSSLCANGSVHGKGSLILRCGSGTLVDSTFLFNAPVT
LQGGMDVKGQVALGPSGSLSISGKTVFRRNSRLVVHLDGKNASPKIKAEGGLELEKNVSL
YPEFFYVPEPGDRIILADGLKKTAGGTFFNLPEGRVFDAEIYRDSPLKTSLAGKASLRIH
YTDTGILLTVLSVDRTAPSP

Enzyme Prediction     

No EC number prediction in MGYG000000870_00444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	46	271	2.7e-33	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	2.08e-39	48	271	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	2.60e-33	46	271	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd02178	GH16_beta_agarase	1.68e-24	48	271	27	257	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
cd02182	GH16_Strep_laminarinase_like	8.20e-16	41	272	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	1.88e-14	73	269	1	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO95751.1	0.0	1	559	1	559
QWO93222.1	0.0	1	559	1	559
QWO91467.1	0.0	1	559	1	559
QWP70560.1	0.0	1	559	1	559
QWO85916.1	0.0	1	559	1	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JH5_A	6.56e-08	42	275	4	235	Structureof Marine bacterial laminarinase [Aquimarina]
6JHJ_A	3.85e-07	42	275	4	235	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23903	9.54e-10	17	271	388	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q9ZG90	3.34e-09	27	274	34	290	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.968084	0.031712	0.000079	0.000056	0.000034	0.000062

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000870_00444.