CAZyme Information: MGYG000000870_00494

Basic Information

• Species: Akkermansia sp004167605
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp004167605
• CAZyme ID: MGYG000000870_00494
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	MGYG000000870_2|CGC2	75220.13	7.4988

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000870	3134704	MAG	United States	North America

• Gene Location: Start: 105417; End: 107459 Strand: +

Full Sequence      

MHSSSLPALALTACSCICLQAATASVTYPGTAPGAAAAHREGDVYSLSNNVLTASWKVSG
NRLVPMGIVNKERPSGAENAVPREQAPELFRLSTEKEDYNLPSSRFVMEGAPSISALKGS
DASPRLGERQEGAVVSAIFRDKKSGVTVHWKAELREGSSYVKETYRIEASKDVDLKKIQL
IDLKDPTLAVKGSVPGSPLVSEREGTFAGIELPVARAQAGGGTGTVGFDCNLPMGSGSVQ
TFTTVLGVWPENQLRRGFLYYLERERAAPYHQFLHYNGWYDDGLDPTEKTLVKTAGEYGK
ELGARHVKLDGFVLDDGWDDVNEDLWQPSTKKFPHGFGPVVKAVGRIPSSFGIWISPLGG
YFGPEKRVQHAKDKGILPEDAAGFDLSCPKYYEWFKKRCSDLMKKDKVTYFKWDKAGDGI
SPHFMALLSIASELRRENPRLFINTTVGTWPSPFWLNHVDSTWRSGTADVGWTGKGNDRE
QWITFRDGACYNVIVKPGPLYPLNSIMHHGMVLGTKFQAERVSKGEDGKQDNRDLKNDAR
IYFGSGANLQELYLTPSMMDKKAWDDIADGARWARRFQDILADVHWVGGNPNRLEPYGYA
AWSPQGCTLALRNPDDQPRTIVLDAATVFEPVKGTPAVFSMKASYPDQRVKTLKLEQGKP
ASLELQPFEVLVFDMRTDRH

Enzyme Prediction     

No EC number prediction in MGYG000000870_00494.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	9.30e-18	275	443	5	194	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.53e-10	268	414	288	441	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02065	Melibiase	1.44e-08	277	414	46	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	0.003	276	344	5	75	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO95801.1	0.0	1	679	1	679
QWO85965.1	0.0	1	679	1	679
QWO91417.1	0.0	1	679	1	679
QWP70609.1	0.0	1	679	1	679
QWO93272.1	0.0	1	679	1	679

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000640	0.862838	0.135549	0.000371	0.000308	0.000252

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000870_00494.