CAZyme Information: MGYG000000870_00646

Basic Information

• Species: Akkermansia sp004167605
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp004167605
• CAZyme ID: MGYG000000870_00646
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1098		123668.55	6.5592

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000870	3134704	MAG	United States	North America

• Gene Location: Start: 269127; End: 272423 Strand: +

Full Sequence      

MKHNDQLLQTLRELGPFYYQPNPGNLGDQVLTQATREYFIRHRLPAHDFDMEVLEKGEPF
TLVYGGGGPFVPYYGMVPQIMRLLGHPLIRRVVILPSSFYQCGEVAQTFDERFTVFCREQ
RSLRYLTGLGSRARLLLADDMAFTLDARALLDSAPATITADPAFRDTLHRLRQSLYTAED
GRKILLMLREDAESRQEGANIRRRYKTFDLSGYSNEPTHDPQRTRFLSTLFLAGLDQADI
ILTDRLHGAVCARLLGKETYMLDNTYGKLAAVYDSSIKGTSHQGMGHTVLLPSLEDFPYR
EQISSTPGKTTKKKILVGICTSQGYSARRDAVRATWLSHPHPDVKCLFFLGGTVPERERA
DTVRLDAPDSYNALPQKILSFFRYALDHHDFDWLFKCDDDTYLDLSRLPELADDRYGIIG
DELLARRLAPSGGAGYMLSRQTVERLVSPAFAGRVPHSGAEDLIFGKLALEAGAAPYSTP
RLFMSNTRYPAPENDTISAHWCGPELLRALETLRHGVPATAYRGTHKYWQDELLFYPDGV
FRRRRTSCYGWWHLGADDVLVLRWKMWNPEQLAWREDAFVGSSVRLERMKGMPSLWELLP
ENETHETANERAGDLPTDETGHTGTRHGTPPAQTEYIHAGCGDRFLEGWLNVDLPHYDLT
APLPWTNGTVKALFLERVAECLTPVEMADFLKEAWRVLAPGGVLRLAFTDTGRLAAEAPA
AWRRFMQDLTGLFPLPGVGLEALMSREGQRSFWSSDSLAGLLTLAGFTVTCHEPGQSPTE
KLRGLEREEARPEFPFELMGRCCLEAQKPEDAPPLACPAAPSRKAATAAPFVAAQPSSTA
PRHMAEDTGPFVSPHFYSGPRTGNRLFQIAAVYAHALRHGLECRIPWRYEELTSRLYEML
GPEAAVCPNGGYDGPVSYHEKRFSYDPIPASITQGRISGYFQTEKYFAGQEKEIRTLFSR
LAAPRREGEAGVHVRMGDYLKLLHKFQTPDAGFLEEAFSRISDNIKTLHIFSDSPQLALD
LVSSVPGAARFELVLNEEGVLPALRAMSSMQELVISCSTFSWWAAWLGNQEKIMVQKKWF
VSEVRDYEDIYRPGWIRL

Enzyme Prediction     

No EC number prediction in MGYG000000870_00646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	861	1097	4.5e-31	0.9637681159420289
GT31	328	413	3.5e-16	0.5104166666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	3.20e-26	861	1089	10	265	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.19e-09	840	1096	22	295	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
pfam01762	Galactosyl_T	2.66e-09	327	480	1	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
COG5039	EpsI	4.16e-08	21	279	38	310	Exopolysaccharide biosynthesis protein EpsI, predicted pyruvyl transferase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
COG4627	COG4627	5.05e-06	633	710	3	88	Predicted SAM-depedendent methyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO91288.1	3.78e-251	314	1098	6	751
QWP70739.1	3.78e-251	314	1098	6	751
QWO93402.1	3.78e-251	314	1098	6	751
QWO95931.1	3.78e-251	314	1098	6	751
QWO86096.1	3.78e-251	314	1098	6	751

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6X1L_A	7.41e-18	5	277	12	259	ChainA, WbbZ protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
7Q4I_A	4.92e-07	314	467	28	188	ChainA, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5F3G7	1.70e-11	308	467	83	246	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1
Q9JJ05	9.29e-11	312	473	86	255	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
Q9JJ06	2.19e-10	301	473	75	255	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
Q0VC84	1.25e-09	312	500	86	279	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
Q18515	7.64e-09	312	513	103	342	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000108	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000870_00646.