CAZyme Information: MGYG000000870_01717

Basic Information

• Species: Akkermansia sp004167605
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp004167605
• CAZyme ID: MGYG000000870_01717
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
710		79206.26	8.9737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000870	3134704	MAG	United States	North America

• Gene Location: Start: 80628; End: 82760 Strand: -

Full Sequence      

MRHFFFPLCSVIALTSFVQAQSPDRHPLYEPALVSAGAAGDAGNLFAGAKVTASGHYGND
RPELAVDGQANNAGKYWGCEGVPVWLQVDMGKPRSLSALHVWPYWEGGRIYKYKIEGSED
GKNWKMLADQSSNSIAATSEGVPFKFNPQTVRYVKITFLGNSAGNDKGGHLVEIKGYGPD
AALNLQAAAVKDYDRIPWSGAPRQEMLQDAVRLSGWRGERAAGQIAVWSSQAQPQLSASC
AGVKNAAGQVIPVRTTMIRYTKGGNRIISDIIGSENGCDLQAGGVRPVWVEVNIPPSAKP
GVYKGKVVVSAESGSPVSVPVILEVAPEFLPAPSNWQVHLDLWQHPQAVARWHDVEPWSP
EHFALMKPVMKRLADAGQKAITCSLIDEAWNAQTYDWFPPMIEWIKGRNGTMRWNYANFD
KWVSFMINEVGIKGQISCYTMIPWNMKIRYLDEATGKYKFLDLKPNDPSYETIWGPFLTD
FRKHVKSKGWLDKTCIGLDERPDAMVKAAKNVLDKYAPEFKIVSAVNRPTAMTRHVYDVS
PVLDHADTVTSDLLAQRKKEGKKTTFYVCVHPKKPNTFTISPLAEAEWLPLFAAANHLDG
FLRWAYNSWNRNPFEKTDFGNWPAGDCYLVYPGNLSSLRFEKLRDGLEEFEKVNILRARA
AKNPKAKAAVARMDEELSKLFTVERSRGDSHEDDVRKAREIIRKTAEATR

Enzyme Prediction     

No EC number prediction in MGYG000000870_01717.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	184	704	1.3e-193	0.9925650557620818
CBM32	52	174	2e-25	0.9193548387096774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	7.25e-25	597	657	1	66	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.
pfam00754	F5_F8_type_C	7.25e-16	50	174	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	6.92e-09	44	156	7	126	Substituted updates: Jan 31, 2002
pfam16391	DUF5000	0.003	67	166	2	138	Domain of unknown function. This family around 200 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO94356.1	0.0	1	710	1	710
QWO90290.1	0.0	1	710	1	710
QWO96918.1	0.0	1	710	1	710
QWO87096.1	0.0	1	710	1	710
QWP71690.1	0.0	1	710	1	710

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L7V_A	3.33e-118	208	702	49	560	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	5.19e-118	208	702	64	575	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5FQE_A	2.42e-70	167	660	17	546	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	3.33e-69	167	660	17	546	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001045	0.996925	0.000775	0.000428	0.000403	0.000384

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000870_01717.