CAZyme Information: MGYG000000870_01773

Basic Information

• Species: Akkermansia sp004167605
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp004167605
• CAZyme ID: MGYG000000870_01773
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747		83639.94	8.7069

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000870	3134704	MAG	United States	North America

• Gene Location: Start: 43150; End: 45393 Strand: +

Full Sequence      

MSMQGFSFSFNRLQQSILVLFLFFLSVFRVASGAPADWKEKTIKENLELVAAWQIAHPVK
RSHLHWTYGAFYSGLMQYALANPQSMKLQTVRTVGEGSQWGILKRPYHADDHAIGHAWME
MAMEDENPAAAEKIRAVLDKVMARPSSASLEFQTPGCQDRWCWSDALFMAPPVFAKLAAY
TGDRRYLEFMDREYKAAYDYLFDKKEGLFYRDSRYFTIPAANGKKMFWSRGNGWVIAGLP
MILQDMPQDWPTRHFYVDLLKRMAAALKKCQSPDGSWHASLMDPAEPPLKEMSGTLFIMY
GMMWGVNQGYLDEKEYLPVIRKAWQAACGAVNAEGALGWVQPIADKPGHYSGNDTEVYGS
GAYLLAGCELRKWVIRQDHPRRKTVSVTNPLNVFRPRETVSVPWNPGKGRDSSRLRVFDV
RNGCVIVHQLADTDGDGRMDTLLFQSNFRAGASRDFWILENSSLDAAPVEGVCFSRHVPE
RLDDFAWENDRTAHRIYGPAVSRPAPEGEGLVSSGTDVWSKKAGVPVINEFYKKGDYHRD
HGNGLDMYNVGPGRGCGGIAVFRDGKAHVSGNWAKVRTLYNGPVQTAFEVSYAPWNVGGG
MKAVETRKVTLDAGSHFTRVRSSVTLNGGNSSEIRVGAGLDTGKKRNSYEVVTADREAGI
MAAWSRPKEDNGCFGTAVMVPWAPDGAAEDGEGCSYWTRSMKSGNSFDWYMGAVWSKASP
VKSAEQWEKEVRRVRDCIRTPLQVKVR

Enzyme Prediction     

No EC number prediction in MGYG000000870_01773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	371	2.7e-84	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.77e-79	63	369	26	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
pfam16153	DUF4861	4.12e-64	387	744	1	382	Domain of unknown function (DUF4861). This family consists of uncharacterized proteins around 400 residues in length and is mainly found in various Bacteroides species. The function of this family is unknown. However, in many instances the domain lies upstream of a glycosyl hydrolase family, usually family 88, so it might be involved in carbohydrate binding.
COG4225	YesR	3.95e-51	61	341	31	314	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO96850.1	0.0	3	747	1	745
QWO87027.1	0.0	13	747	2	736
QWP71621.1	0.0	13	747	2	736
QWO90360.1	0.0	13	747	2	736
QWO94287.1	0.0	13	747	2	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	8.99e-68	38	372	24	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	2.72e-54	53	369	44	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.50e-43	159	369	137	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3QWT_A	1.54e-14	163	358	167	354	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
1NC5_A	1.94e-12	163	370	141	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.61e-79	30	373	44	411	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	6.00e-67	38	372	31	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	2.25e-66	53	372	44	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
T2KN67	3.19e-49	363	746	8	394	Uncharacterized protein P7 OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21960 PE=3 SV=2
O34559	1.06e-11	163	370	141	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999156	0.000146	0.000169	0.000137	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000870_01773.