CAZyme Information: MGYG000000872_00275

Basic Information

• Species: UBA7173 sp900540205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900540205
• CAZyme ID: MGYG000000872_00275
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000000872_2|CGC1	68489.25	4.9757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000872	2772884	MAG	United States	North America

• Gene Location: Start: 111037; End: 112860 Strand: +

Full Sequence      

MVMNRFIIAALMIAATADAASAYSPAGNNIMTTWGEAIDPSAVWQEYPRPIMARGEWQNL
NGLWNYAITGADAAAPADYQGEILVPFCAESALSGVGKEVGADNALWYKRNFTIPKSWRG
RNIMLNFGAVDWQADVWVNGAKVGSHTGGYTPFSLNITPALKNGGDNEVVVRVWDPTDLG
PQPRGKQVAKPEKIWYTSVTGIWQTVWLEPVNETHISNLKILPDIDRNTLRVDVQPSDSA
KGYMTEVTVTDNGKTVATGRAVVGQPVVIPMPGDVKLWTPDNPHLYDLEVKLTLEGKTFD
TVDSYAAMRKFSTKMGDKGMVRLQLNNEDLFHFGLLDQGWWPDGLYTAPSHEAMTYDVDK
TLDWGYNMIRKHIKVEPATWYTYCDRKGIIVWQDMPSGDKDPEWQGRNYFDGEELQRTPQ
SEATYRKEWKEIIDALYNYPCIAVWVPFNEAWGQFKTKEIADWTKTYDPSRLVNPASGGN
HYPCGDMVDAHSYPSPPVTHVYDAKRANVLGEYGGIGMIVDGHIWAPDREFSYINCKTPA
ELTDRYIGYANFLDQLANDWFVGAVYTQTTDVEIEMNGLMTYDRKVIKIDEDRIRETNRR
IIKNHSK

Enzyme Prediction     

No EC number prediction in MGYG000000872_00275.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	48	574	9.2e-104	0.589095744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.48e-33	43	525	1	482	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	7.87e-32	47	474	3	449	beta-D-glucuronidase; Provisional
PRK10340	ebgA	4.67e-14	57	288	41	296	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	1.56e-13	58	208	2	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	3.05e-12	214	309	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13310.1	0.0	3	607	1	605
AHF12404.1	5.16e-306	3	601	1	598
SCD19982.1	4.14e-292	3	601	16	612
QUU05386.1	2.88e-291	3	607	1	604
CUA16942.1	2.88e-291	3	607	1	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.20e-281	23	601	5	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5EUV_A	6.08e-27	58	473	5	389	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d],5EUV_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d],5LDR_B Chain B, Beta-D-galactosidase [Paracoccus sp. 32d]
5LDR_A	6.09e-27	58	473	6	390	ChainA, Beta-D-galactosidase [Paracoccus sp. 32d]
3FN9_A	2.19e-24	103	481	59	436	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
4JKM_A	5.28e-24	59	489	17	464	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM09	2.70e-26	107	478	109	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	3.22e-24	107	482	59	417	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	2.62e-23	44	471	40	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q56307	6.71e-21	38	535	26	533	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KN75	4.18e-19	97	469	76	457	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000215	0.999088	0.000151	0.000189	0.000162	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000872_00275.