CAZyme Information: MGYG000000872_01544

Basic Information

• Species: UBA7173 sp900540205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900540205
• CAZyme ID: MGYG000000872_01544
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		41419.3	8.4356

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000872	2772884	MAG	United States	North America

• Gene Location: Start: 18518; End: 19639 Strand: +

Full Sequence      

MKIFLSAGEASGDLHAGALIGQLRKLQPDTEFAFLGGDMMAEAAGCAPIIHYKDMAYMGY
TQVIKNLGKIFHNMKAAKKAIAEFRPDALVLVDYPGFNLKLAAFAHGLGIPVYYYISPKV
WAWKEWRVKDIKKYCTKVLSILPFEVEFFRRHGMEVEYVGNPSVEEVDRKEAELQPLAGF
VEQWRLPADRPLLALVPGSRRSEIAKNLPIMEEVACRFPQFQPVVAGAPAIERSFYRDFT
TLPLVDDATFELVRNSSCALVTSGTATLETALLGTPQVVCYRGNGTKLTYNIMRRLLKIP
FVSLPNLIADSAIVPEMLLYRCTPDTVAAELEKILPGTPGRDEMLRGYARMRGRLGNSNA
PARAAEVILNTIS

Enzyme Prediction     

No EC number prediction in MGYG000000872_01544.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	354	9.3e-114	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.01e-120	1	372	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.21e-112	1	373	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.51e-89	3	368	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.72e-75	3	369	8	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.28e-56	1	318	2	300	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	1.24e-151	1	373	1	375
QQR08529.1	1.31e-147	1	368	1	370
ASB37800.1	1.31e-147	1	368	1	370
ANU64105.1	1.31e-147	1	368	1	370
QCP71596.1	2.01e-125	1	373	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.63e-42	1	369	7	378	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.63e-42	1	369	7	378	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.13e-85	2	372	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2IL69	8.58e-73	2	372	10	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	4.79e-72	2	372	10	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.34e-71	2	372	10	382	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q1INL4	1.84e-71	1	370	2	376	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000872_01544.