CAZyme Information: MGYG000000872_01887

Basic Information

• Species: UBA7173 sp900540205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900540205
• CAZyme ID: MGYG000000872_01887
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	MGYG000000872_27|CGC2	88786.24	6.4163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000872	2772884	MAG	United States	North America

• Gene Location: Start: 23743; End: 26058 Strand: -

Full Sequence      

MNNKTITFLAAAILSAASASATPDTDKEAAKVRGIITKVNNHWQQTNPPETRSFWDNAAY
HTGNMEAYFLTGNEEWKDYSERWAEHNGWMGAKGTDRSRWKYDYGETDDHVLFGDWQICF
QTYADLYRILPDDRRIRRAREVMEYEMSTPRNDYWWWADGLYMVMPVMTKMHRITGDKKY
LDKLYEYVLVSDSIMYDPDEALYYRDAKYVYPKHKSANGKKDFWARGDGWVLAGLAKVLK
DVPADWEHRPFFTDKYVRMADAVVKLQQPGGYWSRSMMDEAHAPGPETSGTAFFTYGLLW
GINNGYLNDARYLEAAKKGWKYLSEKALQPDGSVGYVQPIGEKAIPGQVVDVRSTSNFGT
GAFLLAACEYVRYLERHRNADRDYWTSLAYNMAAPVLSNMAEGTLQKNMLVEVSPNWDGR
DIKVTYMEAFGRLMAGIAPWLSLPDDDTPECTQRKQLRQWALASYRNAVDPDSPDCLLWS
GQGQALVDAAYVAESFLRAYDALWVPLDDITKQRYIEAFKGLRRIDPPYTNWLLFSSTIE
SFLAKAGADCDEYRVNSAIRKVEEWYTGDGWYADGPVFAFDYYSSYVFHPMYLETLQAMI
DSGRYTRIHYKKHYDRALKRTQKFSIVLERLISPEGTFPVFGRSIPYRMAAMQPLALMAW
YGRLPDGLTDGQVRSALTTVMHRMFDGKENFNEKGFLTIGFTGRQPNVADWYTNNGSLYM
TSLAFLPLGLPPTHPFWSDAPLAWTSQKAWGSQPFPKDHQWKDEIRTHDLF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	381	740	1.6e-104	0.9885057471264368
GH105	46	372	3.4e-80	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10022	DUF2264	3.58e-150	381	744	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
pfam07470	Glyco_hydro_88	1.69e-90	35	374	9	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4289	COG4289	4.17e-64	423	748	52	371	Uncharacterized protein [Function unknown].
COG4225	YesR	2.67e-38	63	372	44	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36089.1	0.0	18	771	19	772
QQY40390.1	0.0	28	771	28	771
QEW35177.1	0.0	28	771	28	771
ABR38224.1	0.0	28	771	29	772
AND21736.1	0.0	28	771	28	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	7.71e-185	8	375	9	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.51e-146	35	375	19	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	6.28e-52	43	372	39	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	1.14e-13	37	369	23	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.48e-13	37	369	13	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	4.10e-51	43	372	46	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	9.97e-50	43	375	44	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	6.44e-41	155	369	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	6.26e-13	37	369	23	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000490	0.998587	0.000216	0.000259	0.000234	0.000205

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000872_01887.