CAZyme Information: MGYG000000872_02213

Basic Information

• Species: UBA7173 sp900540205
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900540205
• CAZyme ID: MGYG000000872_02213
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		39946.19	7.9934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000872	2772884	MAG	United States	North America

• Gene Location: Start: 37; End: 1110 Strand: -

Full Sequence      

MKKGEKPAKFLVIRFRQMGDAVLATSLCNAIKANFPDAEVHMVLNDAIAPLFERHPSINR
VVRFTNDERHSALVYLAKIWRLMRSERYDVVIDMRSTVNTLPFSLFSLRSPFRIGLKKPY
TRFVFNHRVEPCDPFTSVVDHDVHMLAPLGKVKPLNFDATFSLNVTPAELADYRSYLGAQ
GVDTSKPILLCGVVSKLAFKCWPQDFMVEILRRIITSFPSLQLVFNYAPGVEAEAAHNIY
KELGEPSGVFIDVQAPSMRSLVALASHCSAYFGNEGGARHIVQAVGRPSLVVFSPDVRKE
NWLPQTDVPAIGISPSDVLSPEMSAQMSYEDRYSAVTPDVVWERLEPFLRGVIANGC

Enzyme Prediction     

No EC number prediction in MGYG000000872_02213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	305	1.6e-27	0.8488888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	9.78e-42	9	350	3	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	2.84e-38	9	346	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.79e-10	6	307	4	301	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	5.61e-09	77	295	2	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03820	GT4_AmsD-like	0.008	24	111	19	110	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ48104.1	1.87e-124	6	350	2	349
QUT78842.1	1.87e-124	6	350	2	349
QDM10840.1	1.87e-124	6	350	2	349
SCV07513.1	1.87e-124	6	350	2	349
QGT72869.1	1.87e-124	6	350	2	349

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37421	1.89e-07	9	295	2	289	ADP-heptose--LPS heptosyltransferase 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaF PE=3 SV=1
P45042	7.92e-06	11	295	4	289	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000872_02213.