CAZyme Information: MGYG000000873_00088

Basic Information

• Species: Porphyromonas sp900539765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900539765
• CAZyme ID: MGYG000000873_00088
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000000873_2|CGC1	39472.34	7.0274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000873	2049752	MAG	United States	North America

• Gene Location: Start: 2741; End: 3778 Strand: +

Full Sequence      

MNHSRRKEIRRDPTRMRRLLRSITLSLWGAVLVGIVYYFVVVHQAAQTETARTQAAPQTE
WHDVPIAEVGAGEVYEELEQYSTLYVLEYLLDYDSIWPHDELRRLKLFGLYDEDDDDDDD
DEKEKVVVKVKEQPTKSTKSTKPTTASEASSKQSQAQSPKRPGVISDWDHLFQQYGERYG
WDWCVLASIAYQESKFRAGIVGMGGATGLMGIMPATGRRYGYSRAKLKNAENSVHVACMA
LRDFGRAFAHITDAEQRMKFTLASYNAGNAHVLDARRLAERAELDPDRWDDSVEIYMARL
NEPKYYKDPLVQHGRANGAHTVRYVAEVFNRAQSYKKKVQYATAE

Enzyme Prediction     

No EC number prediction in MGYG000000873_00088.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	178	341	6.8e-21	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.60e-64	172	337	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	2.02e-27	164	328	267	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	7.85e-23	167	326	289	441	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	3.10e-13	171	289	9	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.20e-12	172	279	1	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12384.1	7.55e-192	1	345	1	331
BAK25352.1	1.10e-51	160	338	291	471
AUR47574.1	1.10e-51	160	338	291	471
AKV63991.1	3.00e-51	161	338	292	471
ALO29436.1	3.00e-51	161	338	292	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	4.47e-15	172	328	263	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	4.58e-15	172	328	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	4.58e-15	172	328	270	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	6.45e-15	172	328	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	6.45e-15	172	328	256	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0AQY9	2.15e-17	171	328	292	444	Membrane-bound lytic murein transglycosylase F OS=Maricaulis maris (strain MCS10) OX=394221 GN=mltF PE=3 SV=2
A0L862	2.52e-17	165	328	282	440	Membrane-bound lytic murein transglycosylase F OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=mltF PE=3 SV=2
A8ZWR8	3.88e-17	171	338	289	451	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
Q8EC56	1.03e-16	182	328	291	432	Membrane-bound lytic murein transglycosylase F OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=mltF PE=3 SV=2
A0KUK5	1.87e-16	182	328	291	432	Membrane-bound lytic murein transglycosylase F OS=Shewanella sp. (strain ANA-3) OX=94122 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000002	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42