CAZyme Information: MGYG000000873_00895

Basic Information

• Species: Porphyromonas sp900539765
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900539765
• CAZyme ID: MGYG000000873_00895
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		48104.43	4.796

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000873	2049752	MAG	United States	North America

• Gene Location: Start: 10690; End: 11946 Strand: +

Full Sequence      

MIQIILHFYLHQPFRLKSYPFFNIGSDHYYYDDFANEEILRQVVDRSYRPALELIEQLIE
EYPDFRVALTLSGSVLTQMELHTPDMIQLLKRLVQSGRIEILGEPISHGLCGLYDEEEYA
NQLRMYRTRISSLLGVAPVTLSNPELIYSDHIAQIAHRQGYKAIVTEGAKHLLAWKSPNY
LYNATTEGVALLMRHATLSDAIAHDFARYDSPLYPYTTERFFATLEAEQGDYALVSLPLE
TLGSVWSRETGIFEFFRALPEQGYKRGFTFTTPQEIATHCTPQDTIQATYPVSRMGEERD
TSLWTGNELQQCVIQKLEEWGERIRLSRDQRLLEDWINLQGSDHLFYMTTKLGGPGAFSP
YETPYAAFTNYMNVLSDFLLRVSAEYPTSMGNEELNALLQTIENQNKKIAQLEDQLAK

Enzyme Prediction     

No EC number prediction in MGYG000000873_00895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	6	333	1.8e-49	0.8407310704960835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10795	GH57N_MJA1_like	2.56e-146	4	307	2	306	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.
pfam03065	Glyco_hydro_57	7.36e-49	5	286	1	290	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
COG1449	COG1449	1.49e-41	1	382	84	502	Alpha-amylase/alpha-mannosidase, GH57 family [Carbohydrate transport and metabolism].
cd01022	GH57N_like	1.91e-29	4	306	2	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.
cd10793	GH57N_TLGT_like	3.35e-18	37	165	16	140	N-terminal catalytic domain of 4-alpha-glucanotransferase; glycoside hydrolase family 57 (GH57). 4-alpha-glucanotransferase (TLGT, EC 2.4.1.25) plays a key role in the maltose metabolism. It catalyzes the disproportionation of amylose and the formation of large cyclic alpha-1,4-glucan (cycloamylose) from linear amylose. TLGT functions as a homodimer. Each monomer is composed of two domains, an N-terminal catalytic domain with a (beta/alpha)7 barrel fold and a C-terminal domain with a twisted beta-sandwich fold. Some family members have been designated as alpha-amylases, such as the heat-stable eubacterial amylase from Dictyoglomus thermophilum (DtAmyA) and the extremely thermostable archaeal amylase from Pyrococcus furiosus(PfAmyA). However, both of these proteins are 4-alpha-glucanotransferases. DtAmyA was shown to have transglycosylating activity and PfAmyA exhibits 4-alpha-glucanotransferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12975.1	2.15e-300	1	418	1	418
ATS02640.1	2.58e-141	1	414	1	418
ATR99012.1	2.58e-141	1	414	1	418
ATS07178.1	2.58e-141	1	414	1	418
ATS00898.1	2.58e-141	1	414	1	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1K1X_A	5.12e-06	39	182	22	160	Crystalstructure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis],1K1X_B Crystal structure of 4-alpha-glucanotransferase from thermococcus litoralis [Thermococcus litoralis],1K1Y_A Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose [Thermococcus litoralis],1K1Y_B Crystal structure of thermococcus litoralis 4-alpha-glucanotransferase complexed with acarbose [Thermococcus litoralis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59006	2.15e-57	4	378	3	392	Putative alpha-amylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1611 PE=3 SV=1
Q9V298	1.83e-07	39	182	22	160	Alpha-amylase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=amyA PE=3 SV=1
O57932	1.28e-06	37	125	20	104	Alpha-amylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=amyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000003	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000873_00895.