CAZyme Information: MGYG000000876_00540

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000000876_00540
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		28572.82	8.8161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000876	1718013	MAG	Netherlands	Europe

• Gene Location: Start: 3634; End: 4374 Strand: -

Full Sequence      

MSIPKIIHYCWFGGGAISPENRKCMESWEKYCPDYKIIEWNEQNFDISKNRYVQQAYEAK
KYAFVSDYARLAVVYEHGGIYLDTDVELVRPLDELLELPGFMGFQTNNEVATGLGFGARK
GNPVVQALLRDYDALDFLKADGSADLTPCPERNTRVLQALGVRKDGTRQSIAEMEIFPAE
YFCPMDLYNRKLRVTPKTYSIHRYAESWKPKPSAVSRILQRLLKKHYYTWYCPLRGRIEG
LLRKRT

Enzyme Prediction     

No EC number prediction in MGYG000000876_00540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	96	2.9e-26	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.81e-21	3	130	82	212	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.68e-20	22	96	5	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	9.75e-12	3	132	46	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.004	41	85	153	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZY91881.1	1.04e-80	3	208	2	207
QBS00042.1	3.53e-80	3	208	2	207
CAD0163186.1	4.22e-80	3	208	2	207
CAD0163987.1	4.22e-80	3	208	2	207
AAP32730.1	5.98e-80	3	208	2	207

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQW4	1.52e-09	3	210	2	213	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q10323	8.81e-09	2	137	56	193	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000876_00540.