CAZyme Information: MGYG000000884_01684

Basic Information

• Species: CAG-103 sp900317855
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-103; CAG-103 sp900317855
• CAZyme ID: MGYG000000884_01684
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592		66181.2	8.6483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000884	2163347	MAG	Denmark	Europe

• Gene Location: Start: 4202; End: 5980 Strand: -

Full Sequence      

MAVLRYILLAAAITLTLALLAHLCLPARAPIPRRTGRRGGIAIAVLTAVYAVAAFWNLGS
ARDPQQFCTFEAGESAVLALERETAIAAVWYYPGLSTGEYTLAYSADGVTFTPAGTMPQG
YADLFKWLQPEMADTAPAMAAYVRITASAHMELGELALYDLQGERIGVRDIAGPASADAL
CDEADTVPAASTYYNSTYFDEIYHARTAYEQLRGVYPYEVSHPPLGKEILSLGIVLFGMT
PLGWRFMGTLFGAAMLPLMWDLLRRMFRDDRVALCGAALLAFDFMHLTQTRIATIDSFAT
LFILLMYLFLYRYFTEGRLRHLAACGVTFGIGAATKWTCLYAGAGLGVLWALHWIFAGVR
AHRAGDGRRYARRLLGSIGFCLVFFVLVPGMIYYASYYPYGAARGLHGAGMYFTREYAAI
VLENQRFMFTYHSGLVATHPYASRWWQWLLDLRPILYYLSYGDGTVSTIGAFVNPLLCWG
GLLALPVLAYRAWKRDRTALFILVGYLAQVLPWVFISRLTFEYHYFAATLFLVLALGYVF
DRLRRRGYLGIVYAFTAANGVLFALFYPVLTGVTIPRDYAWNVLKWLPDWPF

Enzyme Prediction     

No EC number prediction in MGYG000000884_01684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	194	400	8.2e-53	0.9192825112107623

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	3.50e-25	422	588	4	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.71e-19	422	592	502	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.45e-15	193	399	17	239	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	4.08e-12	218	498	132	364	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	4.39e-12	221	348	1	127	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	1.85e-161	37	592	63	653
QQR07704.1	1.85e-161	37	592	63	653
QIA32159.1	7.38e-160	37	592	59	649
ALP95330.1	1.86e-151	37	592	74	752
QBB67038.1	3.71e-151	37	592	74	752

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	7.09e-33	220	590	100	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	7.09e-33	220	590	100	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.02e-31	220	590	94	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	1.82e-20	220	590	97	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999994	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
4	26
39	61
241	263
292	314
334	356
376	398
468	490
499	516
521	540
547	569