CAZyme Information: MGYG000000886_00040

Basic Information

• Species: UBA2882 sp900542015
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA2882; UBA2882 sp900542015
• CAZyme ID: MGYG000000886_00040
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724	MGYG000000886_1|CGC2	80377.63	4.8225

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000886	2937871	MAG	Denmark	Europe

• Gene Location: Start: 46790; End: 48964 Strand: +

Full Sequence      

MTQNELKALCDSMTPEEKIGMVHGASLFQTKAVERLNVPAFTYSDGPMGVRLEYQKDEWF
PVGYSDDYTSYLPSNTALASTFNPELAYESGQILGEETRGRGKDMILGPGVNIHRSPLGG
RNFEYMSEDPYLSGRMAVPYIQGVQENDVSACVKHYALNNQETRRNDVDTYVSERALFEI
YLPAFRAAVKEGKTCGLMGSYNKFRKTYCSHHSYLLNEILRGEWGFDGIVVSDWGSIHDT
VEAGNAGIDVDMRVTNDFDEYYFANPLKAAIEDGTVPMEKLDEKIMHILNVMNKLHMLDG
ERKSGTCNQPSTGEKLLKTAEESIILLKNDEKLLPLDKKKIKKLLVIGDNANRMHALGGG
SAEIKALYEISPLLGLKMVLGGNCQVTYKPGYYSYVVGNAWGHDENGQGAGCNPVKKLNP
EEIETLNKEYLADAKAACQDADAVIFIGGLNHDFDVEGKDKDDMRLPYGQDRIIKELLQV
RPDMIVTMITGSPVDMHEWLDEAKTLLYYSYNGMQGGLAFAKTVFGESNPSGKLTMTLPR
VLEDSPAHKLGEFPGNDSVHYNEDIYVGYRYFDTFGVKPAFAFGHGLSYTEFSFGEVSAS
VSEEGGRGNGSGTLPALSVSASVPVSNTGSRDGAVTVQFYIRPADSPIKRPLKELRGFEK
QFLKAGETKEFTAEFDAYSFSYYDEERKCYVTLAGDYEICAAYACDDIRSIAKITIEKEY
TVAR

Enzyme Prediction     

No EC number prediction in MGYG000000886_00040.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	252	3.3e-68	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.52e-81	73	699	121	748	beta-glucosidase BglX.
COG1472	BglX	1.19e-63	13	330	17	344	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	9.85e-51	7	699	54	766	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	8.82e-45	72	291	88	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	2.07e-40	346	569	22	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF54088.1	2.38e-250	3	720	9	712
AQR92992.1	1.10e-248	3	720	9	712
BAV13087.1	7.21e-245	4	718	5	683
ADL49824.1	7.21e-245	4	718	5	683
AXB87221.1	1.44e-244	6	722	6	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.57e-137	5	722	4	680	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.91e-114	1	717	1	664	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.63e-107	5	719	3	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.90e-106	5	719	3	716	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	8.44e-99	1	719	1	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	1.75e-159	13	720	53	745	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	1.95e-136	5	722	4	680	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
A1CA51	3.16e-112	1	708	1	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
E7CY69	2.60e-111	13	717	12	673	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
B0Y3M6	9.13e-111	1	708	1	822	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000886_00040.